Tested Applications
| Positive WB detected in | MG132 treated NIH/3T3 cells, Tunicamycin treated HeLa cells, PC-3 cells, K-562 cells, HepG2 cells, Jurkat cells |
| Positive IP detected in | K-562 cells, NIH/3T3 cells |
| Positive IHC detected in | human pancreas tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MG132 treated U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 12 publications below |
| WB | See 128 publications below |
| IHC | See 11 publications below |
| IF | See 10 publications below |
| IP | See 3 publications below |
| FC | See 1 publications below |
Product Information
10449-1-AP targets GADD34 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, monkey, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0578 Product name: Recombinant human GADD34 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 307-572 aa of BC003067 Sequence: SDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAG Predict reactive species |
| Full Name | protein phosphatase 1, regulatory (inhibitor) subunit 15A |
| Calculated Molecular Weight | 73 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC003067 |
| Gene Symbol | GADD34 |
| Gene ID (NCBI) | 23645 |
| RRID | AB_2168724 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75807 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GADD34, also named PPP1R15A, belongs to the PPP1R15 family. GADD34 can be triggered as a direct target of activating transcription factor4 (ATF4) under ER stress, it plays a pivotal role in the recovery of cells from shut-down of translation induced by ER stress. It recruits the serine/threonine-protein phosphatase (PP1) to dephosphorylate the translation initiation factor eIF2alpha, thereby reversing the shut-off of protein synthesis initiated by stress-inducible kinases and facilitating recovery of cells from stress. GADD34 down-regulates the TGF-beta signaling pathway by promoting dephosphorylation of TGFB1 via PP1. It may also promote apoptosis by inducing TP53 phosphorylation on 'Ser-15'. Starvation-induced expression of GADD34 reduced mTOR activity and induced autophagy in wild-type mice, but not in GADD34 KO mice. Molecular weight of GADD34 is 100 kDa confirmed in GADD34 KO mice, and Proteintech's GADD34 antibody 10449-1-AP primarily recongize the 100 kDa band.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GADD34 antibody 10449-1-AP | Download protocol |
| IHC protocol for GADD34 antibody 10449-1-AP | Download protocol |
| IP protocol for GADD34 antibody 10449-1-AP | Download protocol |
| WB protocol for GADD34 antibody 10449-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Science Preventing proteostasis diseases by selective inhibition of a phosphatase regulatory subunit. | ||
Science Selective inhibition of a regulatory subunit of protein phosphatase 1 restores proteostasis. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Ana (Verified Customer) (03-11-2021) | GADD34 in mouse muscle. 10 ug of protein. BSA blocking. 1:1000 primary ab dilution O/N incubation 4ºC.1:5000 secondary ab HRP conjugated.
![]() |
FH Maria (Verified Customer) (02-10-2021) | GADD34 in human primary fibroblasts. UT and TN treated. PFA 4% 20 min. Blocking: PBST (0.1% Triton) 10% Goat Serum 1h RT. Primary incubation: 16h 4ºC 1:200 in PBST 10% GS. Secondary: 2h RT 1:500 Goat anti-rabbit Alexa fluor 555 in PBST 10% GS.
![]() |
FH Daniel (Verified Customer) (10-01-2019) | Cytoplasmic staining of the tubules of wild-type kidneys.
![]() |
FH Stefan (Verified Customer) (07-31-2019) | See publication:Dalton LE, Clarke HJ, Knight J, Lawson MH, Wason J, Lomas DA, Howat WJ, Rintoul RC, Rassl DM, Marciniak SJ. (2013). The endoplasmic reticulum stress marker CHOP predicts survival in malignant mesothelioma. Br J Cancer. 2013 Apr 2;108(6):1340-7. doi: 10.1038/bjc.2013.66. Epub 2013 Feb 14.https://www.nature.com/articles/bjc201366
![]() |





























