Featured Product
KD/KO Validated

PSAP Polyclonal antibody

PSAP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18423-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

A1 activator, Cerebroside sulfate activator, Co beta glucosidase, Component C, CSAct

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 18423-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 18423-1-AP (PSAP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 18423-1-AP
WB result of PSAP antibody (18423-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSAP transfected HepG2 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 18423-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 18423-1-AP (PSAP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 18423-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 18423-1-AP (PSAP Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 18423-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18423-1-AP (PSAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 18423-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18423-1-AP (PSAP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 18423-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18423-1-AP (PSAP Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 18423-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18423-1-AP (PSAP Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate cancer using 18423-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18423-1-AP (PSAP Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate cancer using 18423-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 18423-1-AP (PSAP Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PSAP in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293T cells, HeLa cells, HepG2 cells
Positive IHC detected in	mouse brain tissue, human liver cancer tissue, human prostate cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18423-1-AP targets PSAP in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag13266 Product name: Recombinant human PSAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 406-487 aa of BC001503 Sequence: GGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHK Predict reactive species
Full Name	prosaposin
Calculated Molecular Weight	58 kDa
Observed Molecular Weight	60-70 kDa
GenBank Accession Number	BC001503
Gene Symbol	PSAP
Gene ID (NCBI)	5660
RRID	AB_10643525
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P07602
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

proteins' (SAPs) that assist in the lysosomal hydrolysis of sphingolipids. After proteolytic processing of the presaposin protein, these 4 released polypeptides are functional activators. Saposin A was encoded by residues 60 to 143 of PSAP, saposin B by 195 to 275, saposin C by 311 to 390, and saposin D by 405 to 487. There are four 12-14 kDa heatstable glycoproteins. This antibody should recognize saposin D.

Protocols

Product Specific Protocols
IHC protocol for PSAP antibody 18423-1-AP	Download protocol
WB protocol for PSAP antibody 18423-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PSAP Polyclonal antibody (Cat# 18423-1-AP) has 1 citation. It appears in the Journal of Neurochemistry, in a study investigating prosaposin cleavage into saposins by multiple cathepsins under progranulin regulation. The research falls within neurochemistry and lysosomal biology, focusing on proteolytic processing of presaposin. The cited application was Western blot in human samples.

Species	Application	Title
human	WB	J Neurochem Prosaposin Is Cleaved Into Saposins by Multiple Cathepsins in a Progranulin-Regulated Fashion. Authors - Molly Hodul View Article