PTAFR Polyclonal antibody

PTAFR Polyclonal Antibody for IHC, ELISA

Cat No. 20921-1-AP

Publications(2)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

PAF R, PAFR, PAF-R, Platelet-activating factor receptor

Formulation: PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHC

IHC staining of human lung using 20921-1-AP
Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 20921-1-AP (PTAFR Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung using 20921-1-AP
Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 20921-1-AP (PTAFR Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 20921-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 20921-1-AP (PTAFR Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 20921-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 20921-1-AP (PTAFR Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in

human lung tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20921-1-AP targets PTAFR in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15128 Product name: Recombinant human PTAFR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 245-342 aa of BC013816 Sequence: FVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKFRKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN Predict reactive species
Full Name	platelet-activating factor receptor
Calculated Molecular Weight	342 aa, 39 kDa
GenBank Accession Number	BC013816
Gene Symbol	PTAFR
Gene ID (NCBI)	5724
RRID	AB_2878766
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P25105
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for PTAFR antibody 20921-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human		Nat Struct Mol Biol Structural basis for signal recognition and transduction by platelet-activating-factor receptor. Authors - Can Cao View Article
mouse	WB	Gut Pathog Virulence factors and mechanisms of paediatric pneumonia caused by Enterococcus faecalis Authors - Zhiying Tian View Article