Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

COX-1/Cyclooxygenase-1 Polyclonal antibody

COX-1/Cyclooxygenase-1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13393-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, IP, ELISA

PGH1, PTGS1, COX1, Cyclooxygenase-1, EC:1.14.99.1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, Neuro-2a cells, HeLa cells, THP-1 cells, C2C12 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13393-1-AP targets COX-1/Cyclooxygenase-1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4055

Product name: Recombinant human PTGS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 250-599 aa of BC029840

Sequence: KLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL

Predict reactive species
Full Name prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
Calculated Molecular Weight 599 aa, 69 kDa
Observed Molecular Weight 60-72 kDa
GenBank Accession NumberBC029840
Gene Symbol PTGS1
Gene ID (NCBI) 5742
RRIDAB_10644323
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23219
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTGS1(Prostaglandin G/H synthase 1) belongs to the prostaglandin G/H synthase family and catalyzes the conversion of arachidonic acid to prostaglandin H2, which is subsequently metabolized to various biologically active prostaglandins. It is also named as COX1(Cyclooxygenase-1). There is no PTGS1 expression in fetal samples (prostate, seminal vesicles, or ejaculatory ducts), and only minimal expression in adult tissues (PMID: 10999846). PTGS1 has some isoforms with MW of 56-72 kD and PTGS1 can form homodimer.

Protocols

Product Specific Protocols
IHC protocol for COX-1/Cyclooxygenase-1 antibody 13393-1-APDownload protocol
IP protocol for COX-1/Cyclooxygenase-1 antibody 13393-1-APDownload protocol
WB protocol for COX-1/Cyclooxygenase-1 antibody 13393-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
ratWB

Acta Pharm Sin B

Organic carbon monoxide prodrug, BW-CO-111, in protection against chemically-induced gastric mucosal damage.

Authors - Dominik Bakalarz
WB

Small

M2 Macrophage Membrane-Mediated Biomimetic-Nanoparticle Carrying COX-siRNA Targeted Delivery for Prevention of Tendon Adhesions by Inhibiting Inflammation

Authors - Jie Sun
mouseWB

Theranostics

Nanozyme-mediated catalytic nanotherapy for inflammatory bowel disease.

Authors - Jiulong Zhao
ratWB

Elife

Hepatic AMPK signaling dynamic activation in response to REDOX balance are sentinel biomarkers of exercise and antioxidant intervention to improve blood glucose control

Authors - Meiling Wu
humanWB

Free Radic Biol Med

PET117 assembly factor stabilizes translation activator TACO1 thereby upregulates mitochondria-encoded cytochrome C oxidase 1 synthesis

Authors - Qiong Sun
mouseWB

Ecotoxicol Environ Saf

Exposure to nicotine regulates prostaglandin E2 secretion and autophagy of granulosa cells to retard follicular maturation in mammals

Authors - Xiaofeng Zhou

Reviews

    5.0 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Meixin (Verified Customer) (03-10-2026)

This antibody performs well in Western blot. A clear band was detected at the expected size with minimal background. Used at 1:1000 dilution and the results were consistent across experiments.

  • Applications: Western Blot

Mounika (Verified Customer) (01-08-2026)

Amazing antibodies, works very well, bands size are precise!

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:600

Thomas (Verified Customer) (09-18-2020)

HeLa cells were fixed in 4% PFA for 15 mins and permeabilised in 0.1% Triton-X 100 in PBS. Cells were blocked in 1% BSA. Primary antibody solution was diluted at 1:200 in blocking solution and incubated for 1 hour. Goat anti-rabbit 488 Alexa Fluor secondary antibody (1:250 - green) and DAPI (1:2000 - blue) were incubated with cells for 1 hour.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: HeLa
COX-1/Cyclooxygenase-1 Antibody Immunofluorescence validation (1:200 dilution) in HeLa (Cat no:13393-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...