Tested Applications
Positive WB detected in | U-937 cells |
Positive IF/ICC detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
12106-1-AP targets PTMS in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2751 Product name: Recombinant human PTMS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC017025 Sequence: MSEKSVEAAAELSAKDLKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALKRAAEEEDEADPKRQKTENGASA Predict reactive species |
Full Name | parathymosin |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 10-12 kDa |
GenBank Accession Number | BC017025 |
Gene Symbol | PTMS |
Gene ID (NCBI) | 5763 |
RRID | AB_10665368 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P20962 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PTMS, also named as Parathymosin, is a small nuclear protein that can physically interact with glucocorticoid receptors (GR) and histone H1, respectively, and can serve as a coactivator of GR (PMID: 16150697; PMID: 15716277). It is widely distributed in mammalian tissues. Catalog#12106-1-AP is a rabbit polyclonal antibody raised against the full-length of human PTMS. The MW of this protein is 12 kDa, and this antibody specially recognises the 12 kDa protein.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PTMS antibody 12106-1-AP | Download protocol |
IF protocol for PTMS antibody 12106-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |