Filter: AllWBIHC

WB analysis of mouse liver using 22163-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 22163-1-AP (PXMP3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of mouse liver using 22163-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 22163-1-AP (PXMP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 22163-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 22163-1-AP (PXMP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
WB analysis of mouse brain using 22163-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 22163-1-AP (PXMP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
IHC staining of human liver using 22163-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22163-1-AP (PXMP3 Antibody) at dilution of 1:200 (under 10x lens).
IHC staining of human liver using 22163-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22163-1-AP (PXMP3 Antibody) at dilution of 1:200 (under 40x lens).
IHC staining of mouse brain using 22163-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22163-1-AP (PXMP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PXMP3 Polyclonal antibody

Name: PXMP3 Polyclonal antibody
Brand: Proteintech
SKU: 22163-1-AP

PXMP3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22163-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

PEX2, 35 kDa peroxisomal membrane protein, EC:2.3.2.27, PAF1, PAF-1

Formulation: PBS and Azide

PBS and Azide

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

Positive WB detected in	mouse liver tissue, HeLa cells, mouse brain tissue
Positive IHC detected in	human liver tissue, mouse brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

IF	See 1 publications below

22163-1-AP targets PXMP3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag17815 Product name: Recombinant human PXMP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 213-305 aa of BC000661 Sequence: VQKLKAKLSSWCIPLTGAPNSDNTLATSGKECALCGERPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNPL Predict reactive species
Full Name	peroxisomal membrane protein 3, 35kDa
Calculated Molecular Weight	305 aa, 35 kDa
Observed Molecular Weight	35-40 kDa
GenBank Accession Number	BC000661
Gene Symbol	PXMP3
Gene ID (NCBI)	5828
RRID	AB_2879014
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P28328
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
WB protocol for PXMP3 antibody 22163-1-AP	Download protocol
IHC protocol for PXMP3 antibody 22163-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
mouse	IF	Cell Rep Modulation of the cell membrane lipid milieu by peroxisomal β-oxidation induces Rho1 signaling to trigger inflammatory responses. Authors - Anu S Nath View Article