Tested Applications
| Positive WB detected in | HUVEC cells, Neuro-2a cells, SK-N-SH cells |
| Positive IHC detected in | human liver tissue, mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 5 publications below |
| IF | See 1 publications below |
Product Information
26205-1-AP targets FAM38B in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24528 Product name: Recombinant human FAM38B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 306-401 aa of AB527139 Sequence: KQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN Predict reactive species |
| Full Name | family with sequence similarity 38, member B |
| Calculated Molecular Weight | 318 kDa |
| Observed Molecular Weight | 80 kDa |
| GenBank Accession Number | AB527139 |
| Gene Symbol | FAM38B |
| Gene ID (NCBI) | 63895 |
| RRID | AB_2880425 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H5I5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAM38B, also named as PIEZO2, is a mechanosensitive, rapidly inactivating (RI) ion channel which is open and converts the mechanical stimulus signals into bioelectrical signals after stimulated by mechanical signals. FAM38B has been recently identified in dorsal root ganglion (DRG) neurons to mediate tactile transduction. It plays an important role in the biological process, maintaining cell metabolism and cell migration. Loss-of-function mutations in the human FAM38B gene cause an autosomal recessive syndrome of muscular atrophy with perinatal respiratory distress, arthrogryposis, and scoliosis.The 80 kDa band detected by SDS-PAGE can be caused by alternative splicing (PMID: 34335288, 37227654).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FAM38B antibody 26205-1-AP | Download protocol |
| WB protocol for FAM38B antibody 26205-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) The Critical Role of The Piezo1/β-catenin/ATF4 Axis on The Stemness of Gli1+ BMSCs During Simulated Microgravity-Induced Bone Loss | ||
EMBO Mol Med TET3 is a regulator and can be targeted for the intervention of myocardial fibrosis | ||
Glia Mechanosensitive channel Piezo1 is an essential regulator in cell cycle progression of optic nerve head astrocytes | ||
Int J Biol Sci Mechanosensitive Piezo1 is crucial for periosteal stem cell-mediated fracture healing. | ||
Adv Clin Exp Med PIEZO2 promotes cell proliferation and metastasis in colon carcinoma through the SLIT2/ROBO1/VEGFC pathway | ||
Front Mol Neurosci Activation of mechanoreceptor Piezo1 inhibits enteric neuronal growth and migration in vitro |









