Use Able AI chat for product recommendations

Gamma Catenin Monoclonal antibody

Gamma Catenin Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66445-1-Ig
Clone No.1A5D10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, canine

Applications

WB, IHC, IF/ICC, ELISA

JUP, JUP/gamma Catenin, γ-Catenin, ARVD12, Catenin gamma

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman heart tissue, A431 cells, HT-29 cells, MDCK cells, rat heart tissue, T-47D cells
Positive IHC detected inhuman breast cancer tissue, human skin tissue, human stomach cancer tissue, mouse stomach tissue, rat stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66445-1-Ig targets Gamma Catenin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, canine samples.

Tested Reactivity human, mouse, rat, pig, canine
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1627

Product name: Recombinant human JUP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 396-745 aa of BC011865

Sequence: LVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA

Predict reactive species
Full Name junction plakoglobin
Calculated Molecular Weight 82 kDa
Observed Molecular Weight 82 kDa
GenBank Accession NumberBC011865
Gene Symbol Gamma Catenin
Gene ID (NCBI) 3728
RRIDAB_2881814
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP14923
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Plakoglobin (γ-catenin), a member of the Armadillo proteins, plays important roles in cell adhesion with α-catenin and β-catenin, is involved in Wnt signaling, and is translocated into the nucleus and binds LEF1. Plakoglobin is a major cytoplasmic component of both desmosomes and adherens junctions, and is the only known constituent common to submembranous plaques in both of these structures, which are located at the intercalated disc (ICD) of cardiomyocytes. Plakoglobin links cadherins to the actin cytoskeleton. Mutations in plakoglobin are associated with arrhythmogenic right ventricular dysplasia and Pemphigus vulgaris.

Protocols

Product Specific Protocols
IF protocol for Gamma Catenin antibody 66445-1-IgDownload protocol
IHC protocol for Gamma Catenin antibody 66445-1-IgDownload protocol
WB protocol for Gamma Catenin antibody 66445-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Aging (Albany NY)

DSC2 suppresses the growth of gastric cancer through the inhibition of nuclear translocation of γ-catenin and PTEN/PI3K/AKT signaling pathway

Authors - Chao Sun
humanIF

Int J Mol Sci

The Non-Antibacterial Effects of Azithromycin and Other Macrolides on the Bronchial Epithelial Barrier and Cellular Differentiation

Authors - Arni Asbjarnarson
humanWB

Oxid Med Cell Longev

DSC2 Suppresses the Metastasis of Gastric Cancer through Inhibiting the BRD4/Snail Signaling Pathway and the Transcriptional Activity of β-Catenin

Authors - Chao Sun

Reviews

    3.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ashley (Verified Customer) (02-25-2026)

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation, Cell culture
  • Cell Tissue Type: Human

Tom (Verified Customer) (11-02-2023)

Multiple bands and high background in western blot (1:2000, overnight incubation at 4C in 3% BSA PBS 0.1% Tween on PVDF membrane). Non-specific (and non-junctional) signalling in immunoflouresence (1:200, 4% PFA fixed cells).

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:2000 (WB) , 1:200 (IF)
  • Cell Tissue Type: HUVEC
Gamma Catenin Antibody Western Blot,Immunofluorescence validation (1:2000 (WB) , 1:200 (IF) dilution) in HUVEC (Cat no:66445-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...