• Featured Product
  • KD/KO Validated

QKI Polyclonal antibody

QKI Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 13169-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

QK, Protein quaking, KH domain-containing RNA-binding protein QKI, HqkI, Hqk

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNeuro-2a cells, PC-12 cells
Positive IP detected inK-562 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:150-1:600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13169-1-AP targets QKI in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3822

Product name: Recombinant human QKI protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-341 aa of BC019917

Sequence: MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN

Predict reactive species
Full Name quaking homolog, KH domain RNA binding (mouse)
Calculated Molecular Weight 341 aa, 38 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC019917
Gene Symbol QKI
Gene ID (NCBI) 9444
RRIDAB_2173138
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96PU8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

QKI (Quaking) is RNA-binding protein that plays a central role in myelinization (PMID: 16641098). It regulates pre-mRNA splicing, mRNA export and protein translation (PMID: 16641098). It acts upstream of or within several processes, including long-chain fatty acid biosynthetic process, positive regulation of macromolecule metabolic process and vasculogenesis. QKI shuttles internal m7G-modified transcripts into stress granules and modulates mRNA metabolism. It is expressed in the frontal cortex of brain (PMID: 16342280).

Protocols

Product Specific Protocols
IHC protocol for QKI antibody 13169-1-APDownload protocol
IP protocol for QKI antibody 13169-1-APDownload protocol
WB protocol for QKI antibody 13169-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cancer

hsa_circ_0007919 induces LIG1 transcription by binding to FOXA1/TET1 to enhance the DNA damage response and promote gemcitabine resistance in pancreatic ductal adenocarcinoma

Authors - Lei Xu
humanWB,IHC

Cell Oncol (Dordr)

QKI deficiency maintains glioma stem cell stemness by activating the SHH/GLI1 signaling pathway.

Authors - Bo Han
WB

Oxid Med Cell Longev

MicroRNA-155 Promotes Myocardial Infarction-Induced Apoptosis by Targeting RNA-Binding Protein QKI.

Authors - Jing Guo
humanWB

J Biol Chem

MicroRNA-214 Promotes Dendritic Development by Targeting the Schizophrenia-associated Gene Quaking.

Authors - Koichiro Irie
  • KD Validated
humanWB

J Biol Chem

RNA binding protein Quaking stabilizes Sirt2 mRNA during oligodendroglial differentiation.

Authors - Merlin P Thangaraj
human,mouseWB,IHC,IF

J Cell Physiol

Quaking promotes the odontoblastic differentiation of human dental pulp stem cells.

Authors - Shuchen Li
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...