Tested Applications
Positive WB detected in | fetal human brain tissue, human brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 5 publications below |
WB | See 6 publications below |
IHC | See 1 publications below |
IF | See 3 publications below |
FC | See 1 publications below |
Product Information
11792-1-AP targets RAB8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, canine |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2421 Product name: Recombinant human RAB8B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC020654 Sequence: MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL Predict reactive species |
Full Name | RAB8B, member RAS oncogene family |
Calculated Molecular Weight | 207 aa, 24 kDa |
Observed Molecular Weight | 24 kDa |
GenBank Accession Number | BC020654 |
Gene Symbol | RAB8B |
Gene ID (NCBI) | 51762 |
RRID | AB_2253392 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q92930 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The Rab8 GTPase is a member of the Ras superfamily that functions in protein transport and membrane restructuring. RAB8 has two isoforms, RAB8A and RAB8B, that share 40% amino acid identity in the C-terminal variable region. RAB8 activity is regulated by specific guanine nucleotide exchange factors (GEFs), that mediate GTP loading, and GTPase activating proteins (GAPs) that convert them into the inactive GDP-bound form. RAB8 participates in recycling of the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors to the dendritic spine surface as well as in the intracellular transport of the metabotropic glutamate receptor type 1 in neuronal cells. Rab8 is activated at the base of the cilium by its guanine nucleotide exchanger Rabin8. The antibody 11792-1-AP can detect both RAB8A and RAB8B. 55295-1-AP is specific to RAB8B and 55296-1-AP is specific to RAB8A.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RAB8 antibody 11792-1-AP | Download protocol |
IHC protocol for RAB8 antibody 11792-1-AP | Download protocol |
IF protocol for RAB8 antibody 11792-1-AP | Download protocol |
IP protocol for RAB8 antibody 11792-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Cell Biol A molecular network for de novo generation of the apical surface and lumen.
| ||
EMBO J Loss of C9ORF72 impairs autophagy and synergizes with polyQ Ataxin-2 to induce motor neuron dysfunction and cell death. | ||
Arterioscler Thromb Vasc Biol IL-1β Induces LDL Transcytosis by a Novel Pathway Involving LDLR and Rab27a
| ||
Autophagy TGFB1 is secreted through an unconventional pathway dependent on the autophagic machinery and cytoskeletal regulators.
| ||
Hum Mol Genet Rab8b GTPase, a protein transport regulator, is an interacting partner of otoferlin, defective in a human autosomal recessive deafness form. | ||
EMBO Rep OCRL regulates lysosome positioning and mTORC1 activity through SSX2IP-mediated microtubule anchoring.
|