Use Able AI chat for product recommendations

RAMP1 Polyclonal antibody

RAMP1 Polyclonal Antibody for WB, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Calcitonin-receptor-like receptor activity-modifying protein 1, CRLR activity-modifying protein 1, Receptor activity-modifying protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RAMP1 in ?

Tested Applications

Positive WB detected inmouse heart tissue, H9C2 cells, human heart tissue, mouse stomach tissue, rat heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10327-1-AP targets RAMP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0402

Product name: Recombinant human RAMP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-148 aa of BC000548

Sequence: MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV

Predict reactive species
Full Name receptor (G protein-coupled) activity modifying protein 1
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 14 kDa, 33-35 kDa
GenBank Accession NumberBC000548
Gene Symbol RAMP1
Gene ID (NCBI) 10267
RRIDAB_2269270
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60894
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAMP1 (receptor-activity-modifying protein) is a member of the RAMP family of single-transmembrane-domain proteins which consist of an N-terminal extracellular domain, a transmembrane region, and a short intracellular C-terminal tail. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a G protein-coupled receptor, can function as either a calcitonin gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. RAMP1 transports the CRLR to the plasma membrane and then remains associated with it to function as a terminally glycosylated CGRP receptor, while RAMP2 and RAMP3 transfer the CRLR to the cell surface to generate receptors that are preferentially selective for adrenomedullin. RAMP1 can form a homodimer, which migrates at 30-37 kDa on SDS-PAGE. (PMID: 9620797; 16188935; 12051717;PMID: 18384073)

Protocols

Product Specific Protocols
WB protocol for RAMP1 antibody 10327-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-CGRP antibody (Cat# 10327-1-AP) has 15 total citations spanning journals including Cell, Advances in Science, Journal of Headache and Pain, Clinical Science, Diabetes, Obesity and Metabolism, International Journal of Molecular Sciences, Investigative Ophthalmology & Visual Science, Frontiers in Pharmacology, iScience, Journal of Virology, Journal of Biological Chemistry, PLoS ONE, Neuroscience Letters, and Chinese Medicine. Research fields cover neurology/migraine, oncology/tumor microenvironment, wound healing, inflammation, metabolic disease, ophthalmology, and infectious disease.

SpeciesApplicationTitle

Cell

Sensory neurons drive immune exclusion by stimulating a dense extracellular matrix in the breast cancer tumor microenvironment.

Authors - Si-Wei Zhang
mouseWB

Adv Sci (Weinh)

Ultrasound Controlled-Release Hydrogel Promotes Diabetic Wound Healing via Neuroimmune Modulation and Synergistic ROS Scavenging.

Authors - Mofan Li
ratIF

J Headache Pain

Calcitonin gene-related peptide receptor antagonist BIBN4096BS regulates synaptic transmission in the vestibular nucleus and improves vestibular function via PKC/ERK/CREB pathway in an experimental chronic migraine rat model.

Authors - Ruimin Tian
mouseWB,IF

J Headache Pain

Migraine-induced cochlear injury triggers ZBP1-mediated PANoptosis via CGRP signaling.

Authors - Wandi Xu
mouseWB,IF

Chin Med

Acupuncture accelerates wound healing via CGRP-RAMP1-TSP1-mediated macrophage M2 polarization.

Authors - Xiaoer Liu
mouseWB,IHC

Clin Sci (Lond)

CGRP alleviates lipopolysaccharide-induced ARDS inflammation via the HIF-1α signaling pathway

Authors - Renzi Zhang

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer rated this antibody 5 stars after testing it by immunofluorescence at 1:200 dilution in two different cancer cell lines (MG63/LNCaP). The antibody performed perfectly in one cell type but failed to detect RAMP1 in the other, despite both being expected to express the protein. Overall, the user was satisfied with the result but noted inconsistent performance across cell lines.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Beatriz (Verified Customer) (06-25-2026)

The antibody was tested in 2 different cancer cell lines. Both should express RAMP1 protein, the antibody worked perfectly in one cell type but not in the other.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: MG63/LNCaP cell line
Loading...
||
New chat

Able™

正在加载,请稍候...