• Featured Product
  • KD/KO Validated

RBAP48 Monoclonal antibody

RBAP48 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66060-1-Ig
Clone No.5C4D6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

RBBP4, Nucleosome-remodeling factor subunit RBAP48, Histone-binding protein RBBP4, CAF-I p48, CAF-I 48 kDa subunit

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, NIH/3T3 cells, RAW 264.7 cells, Jurkat cell, ROS1728 cells, HSC-T6 cells, L02 cells
Positive IHC detected inhuman cervical cancer tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66060-1-Ig targets RBAP48 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6196

Product name: Recombinant human RBBP4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-425 aa of BC053904

Sequence: MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

Predict reactive species
Full Name retinoblastoma binding protein 4
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC053904
Gene Symbol RBBP4
Gene ID (NCBI) 5928
RRIDAB_11064731
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ09028
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein that belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2/NuRD complex complex that has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of corepressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. A decrease of RbAp48 in the dentate gyrus (DG) of the hippocampus in the brain is suspected to be a main cause of memory loss in normal aging (PMID: 23986399).

Protocols

Product Specific Protocols
FC protocol for RBAP48 antibody 66060-1-IgDownload protocol
IF protocol for RBAP48 antibody 66060-1-IgDownload protocol
IHC protocol for RBAP48 antibody 66060-1-IgDownload protocol
WB protocol for RBAP48 antibody 66060-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Dev Cell

Nucleoporin Seh1 controls murine neocortical development via transcriptional repression of p21 in neural stem cells

Authors - Wenxiu Dai
Loading...
||
New chat

Able

正在加载,请稍候...