Use Able AI chat for product recommendations

RBM7 Polyclonal antibody

RBM7 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21896-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

RNA-binding protein 7, RNA-binding motif protein 7, RNA binding protein 7, RNA binding motif protein 7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells
Positive IHC detected inhuman liver cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21896-1-AP targets RBM7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11106

Product name: Recombinant human RBM7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 5-266 aa of BC034381

Sequence: AAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH

Predict reactive species
Full Name RNA binding motif protein 7
Calculated Molecular Weight 266 aa, 31 kDa
Observed Molecular Weight 30-35 kDa
GenBank Accession NumberBC034381
Gene Symbol RBM7
Gene ID (NCBI) 10179
RRIDAB_2878938
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y580
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBM7 (RNA-binding motif protein 7) is an RNA-binding protein initially described to associate with splicing factors, presumably to target intronic RNA for decay (PMID: 35688134). RBM7 regulates the nuclear degradation of NEAT1 non-coding RNA, resulting in sustained apoptosis in the lung epithelium and fibrosis (PMID: 32708315).

Protocols

Product Specific Protocols
IF protocol for RBM7 antibody 21896-1-APDownload protocol
IHC protocol for RBM7 antibody 21896-1-APDownload protocol
WB protocol for RBM7 antibody 21896-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Nat Commun

Temporal-iCLIP captures co-transcriptional RNA-protein interactions

Authors - Ross A Cordiner
humanWB

MedComm (2020)

FBXW7 Targets the SPT6-ΔNp63 Axis for Degradation to Inhibit Esophageal Tumorigenesis Induced by 4-Nitroquinoline N-Oxide.

Authors - Jiagui Zhang
humanWB

Nucleic Acids Res

The NEXT complex regulates H3K27me3 levels to affect cancer progression by degrading G4/U-rich lncRNAs

Authors - Qianqian Yang
  • KD Validated
humanWB

Mol Cell

P-TEFb Activation by RBM7 Shapes a Pro-survival Transcriptional Response to Genotoxic Stress.

Authors - Andrii Bugai

Cell

MYC binding to nascent RNA suppresses innate immune signaling by R-loop-derived RNA-DNA hybrids

Authors - Leonie Uhl
humanWB

Mol Genet Genomics

RBM7 suppresses mitochondrial dysfunction and ferroptosis by destabilizing FBXL16 mRNA to enhance Temozolomide resistance in glioblastoma.

Authors - Nan Liu

Reviews

    5.0 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Aleksandr (Verified Customer) (12-16-2024)

Specific antibody!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: RKO
RBM7 Antibody Western Blot validation (1:3000 dilution) in RKO (Cat no:21896-1-AP)

Tsimafei (Verified Customer) (11-19-2024)

Great antibody that detect Rbm7 in U2OS cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: U2OS
RBM7 Antibody Western Blot validation (1:2000 dilution) in U2OS (Cat no:21896-1-AP)

Moritz (Verified Customer) (08-20-2024)

I used this antibody to detect RBM7 with Western blot in HEK293T WT cell lysate, which worked perfectly.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293T WT
RBM7 Antibody Western Blot validation (1:3000 dilution) in HEK293T WT (Cat no:21896-1-AP)

Roy (Verified Customer) (06-15-2024)

Works well to detect the NEXT complex subunit RBM7 from HeLa extracts (1/1000 Dilution, overnight Incubation at 4°C).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa
Loading...
||
New chat

Able

正在加载,请稍候...