Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 18 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
14895-1-AP targets RBX1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, eriocheir sinensis |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6685 Product name: Recombinant human RBX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC001466 Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH Predict reactive species |
| Full Name | ring-box 1 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC001466 |
| Gene Symbol | RBX1 |
| Gene ID (NCBI) | 9978 |
| RRID | AB_2179719 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62877 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RBX1(RING-box protein 1) is also named as RNF75, ROC1 and is a requisite component of the multi- subunit SCF family E3s36-40.It mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RBX1 antibody 14895-1-AP | Download protocol |
| IP protocol for RBX1 antibody 14895-1-AP | Download protocol |
| WB protocol for RBX1 antibody 14895-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Differ CRL2-KLHDC3 E3 ubiquitin ligase complex suppresses ferroptosis through promoting p14ARF degradation. | ||
Elife Discovery of a molecular glue promoting CDK12-DDB1 interaction to trigger cyclin K degradation. | ||
Cell Death Dis Bcl-3 regulates TGFβ signaling by stabilizing Smad3 during breast cancer pulmonary metastasis. | ||
Neurobiol Aging SQSTM1/ p62 oligomerization contributes to Aβ-induced inhibition of Nrf2 signaling. | ||
Microvasc Res A positive feedback loop between miR-574-3p and HIF-1α in promoting angiogenesis under hypoxia | ||
Gene Expression pattern and functional analysis of the two RING box protein RBX in spermatogenesis of Chinese mitten crab Eriocheir sinensis. |
