Tested Applications
| Positive WB detected in | COS-7 cells, HeLa cells, Jurkat cells, mouse liver tissue, C6 cells, mouse brain tissue, mouse lung tissue, rat brain tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26105-1-AP targets Radixin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
| Tested Reactivity | human, mouse, rat, monkey |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23532 Product name: Recombinant human RDX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 384-455 aa of BC047109 Sequence: EEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQED Predict reactive species |
| Full Name | radixin |
| Calculated Molecular Weight | 583 aa, 68 kDa |
| Observed Molecular Weight | 70-75 kDa |
| GenBank Accession Number | BC047109 |
| Gene Symbol | RDX |
| Gene ID (NCBI) | 5962 |
| RRID | AB_2880380 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35241 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Radixin belongs to the ezrin-radixin-moesin (ERM) family of proteins which act as cross-linkers between membrane and actin cytoskeleton. ERM proteins provide structural links to strengthen the cell cortex and facilitate several key cellular processes, including membrane dynamics, substrate adhesion, cell survival, cell adhesion, and motility. The function of ERM proteins is highly reliant on phosphorylation induced conformational changes in response to chemokine and antigen stimulation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Radixin antibody 26105-1-AP | Download protocol |
| WB protocol for Radixin antibody 26105-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
