• Featured Product
  • KD/KO Validated

RHOB Polyclonal antibody

RHOB Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14326-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

ARH6, ARHB, h6, Rho cDNA clone 6, Rho-related GTP-binding protein RhoB

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HEK-293 cells, HeLa cells, SH-SY5Y cells, rat brain tissue
Positive IP detected inHeLa cells, mouse brain tissue
Positive IHC detected inhuman brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:150-1:600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14326-1-AP targets RHOB in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5593

Product name: Recombinant human RHOB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-196 aa of BC066954

Sequence: MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

Predict reactive species
Full Name ras homolog gene family, member B
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22-26 kDa
GenBank Accession NumberBC066954
Gene Symbol RHOB
Gene ID (NCBI) 388
RRIDAB_2179092
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP62745
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rho-related GTP-binding protein RhoB (RHOB) is also named ARH6, ARHB and Rho cDNA clone 6 (h6). RhoB was the first member of the Rho family to be implicated in endosomal trafficking. One study showed that RhoB localizes and activates its downstream target, serine/threonine kinase (PRK1), on endosomes, and acts through this signaling pathway to disrupt the trafficking of internalized EGF receptor from endosomes to a prelysosomal compartment (PMID: 29385717). RhoB is known to be part of the immediate early genetic response to epidermal growth factor, transforming growth factor β, Src activation, or genotoxic stress (PMID:9545335, PMID: 10679283). RhoB was shown to have potential implications for EGF signaling by targeting the activated EGF receptors to the lysosome, which represents an "off-switch" for mitogenic signals (PMID: 1050858). RhoB was also demonstrated to exert a negative regulatory influence on TGF-β-induced transcriptional activation (PMID:9545335). The activity of the RhoB promoter was stimulated by genotoxic treatments indicating its role in the cellular response to DNA damage (PMID:9388198).

Protocols

Product Specific Protocols
IF protocol for RHOB antibody 14326-1-APDownload protocol
IHC protocol for RHOB antibody 14326-1-APDownload protocol
IP protocol for RHOB antibody 14326-1-APDownload protocol
WB protocol for RHOB antibody 14326-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Mol Cancer

Hsa-miR-3178/RhoB/PI3K/Akt, a novel signaling pathway regulates ABC transporters to reverse gemcitabine resistance in pancreatic cancer.

Authors - Jianyou Gu
humanWB,IF

Nat Commun

ATR/Chk1 signaling induces autophagy through sumoylated RhoB-mediated lysosomal translocation of TSC2 after DNA damage.

Authors - Mingdong Liu
  • KO Validated
humanWB

J Med Chem

Discovery of a Novel Small-Molecule Inhibitor Disrupting TRBP-Dicer Interaction against Hepatocellular Carcinoma via the Modulation of microRNA Biogenesis.

Authors - Ting Peng
humanWB

Mol Cancer Ther

Expression signatures of the lipid-based Akt inhibitors phosphatidylinositol ether lipid analogues in NSCLC cells.

Authors - Zhang Chunyu C
  • KD Validated
ratWB

Sci Rep

MicroRNA-223 Attenuates Hypoxia-induced Vascular Remodeling by Targeting RhoB/MLC2 in Pulmonary Arterial Smooth Muscle Cells.

Authors - Yan Zeng
mouseWB

Invest Ophthalmol Vis Sci

Epigenetic ALYREF/UHRF1/RHOB Axis in Corneal Wound Healing and Implications for Epithelial Tumorigenesis

Authors - Hua Zhang
Loading...
||
New chat

Able

正在加载,请稍候...