Tested Applications
| Positive WB detected in | A549 cells, NIH/3T3 cells, C6 cells, HeLa cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:800-1:3200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10632-1-AP targets RHOC in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0988 Product name: Recombinant human RHOC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC007245 Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL Predict reactive species |
| Full Name | ras homolog gene family, member C |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC007245 |
| Gene Symbol | RHOC |
| Gene ID (NCBI) | 389 |
| RRID | AB_10898358 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08134 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ras homolog family member C (RHOC) encodes a Rho-related GTP-binding protein, which belongs to small GTPase superfamily and also Rho family. RHOC. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Expression of RHOC contributes to metastatic phenotype of melanoma cells and is associated with multiple cancers including gastric carcinomas, ovarian carcinomas and breast cancer as well.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RHOC antibody 10632-1-AP | Download protocol |
| IP protocol for RHOC antibody 10632-1-AP | Download protocol |
| WB protocol for RHOC antibody 10632-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RHOC Polyclonal antibody (Cat# 10632-1-AP) has 19 citations published in journals including Cell Discovery, J Exp Clin Cancer Res, Cell Death & Disease, Oncotarget, Sci Rep, Oncol Rep, Front Mol Biosci, FASEB J, Exp Cell Res, Mol Carcinog, J Cancer, PLoS One, Gene, Tumour Biol, BBRC, Onco Targets Ther, and Open Life Sci. Research fields span cancer biology (lung, ovarian, nasopharyngeal, bladder, colon, breast, liver, glioma), cell signaling pathways (Rho/Rac, Wnt/β-catenin, PI3K/AKT), metastasis, migration, angiogenesis, and lncRNA-mediated regulation.
| Species | Application | Title |
|---|---|---|
Cell Discov Long non-coding RNA MT1DP shunts the cellular defense to cytotoxicity through crosstalk with MT1H and RhoC in cadmium stress. | ||
J Exp Clin Cancer Res Long noncoding RNA AFAP1-AS1 acts as a competing endogenous RNA of miR-423-5p to facilitate nasopharyngeal carcinoma metastasis through regulating the Rho/Rac pathway. | ||
Cell Death Dis Septin11 promotes hepatocellular carcinoma cell motility by activating RhoA to regulate cytoskeleton and cell adhesion | ||
Oncotarget Upregulated long non-coding RNA AFAP1-AS1 expression is associated with progression and poor prognosis of nasopharyngeal carcinoma. | ||
Sci Rep KIFC3 promotes the proliferation, migration and invasion of non-small cell lung cancer through the PI3K/AKT signaling pathway | ||
Oncol Rep Effects and mechanism of RhoC downregulation in suppressing ovarian cancer stem cell proliferation, drug resistance, invasion and metastasis. |
