Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 6 publications below |
Product Information
24576-1-AP targets RIM1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20161 Product name: Recombinant human RIMS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 923-1039 aa of BC152435 Sequence: KSTTLTVPEQQRTTHHRSRSVSPHRGNDQGKPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSELLMLPRAKRGRSAECLHTTR Predict reactive species |
| Full Name | regulating synaptic membrane exocytosis 1 |
| Calculated Molecular Weight | 1692 aa, 189 kDa |
| Observed Molecular Weight | 189 kDa |
| GenBank Accession Number | BC152435 |
| Gene Symbol | RIMS1 |
| Gene ID (NCBI) | 22999 |
| RRID | AB_2879618 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86UR5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RIMS1 is a RAS gene superfamily member that regulates synaptic vesicle exocytosis. RIMS1 also plays a role in the regulation of voltage-gated calcium channels during neurotransmitter and insulin release. Mutations in RIMS1 have suggested a role cognition and have been identified as the cause of cone-rod dystrophy type 7.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RIM1 antibody 24576-1-AP | Download protocol |
| IP protocol for RIM1 antibody 24576-1-AP | Download protocol |
| WB protocol for RIM1 antibody 24576-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Neuron Differential Regulation of Evoked and Spontaneous Release by Presynaptic NMDA Receptors
| ||
iScience Using brain cell-type-specific protein interactomes to interpret neurodevelopmental genetic signals in schizophrenia | ||
Neurochem Res Abnormal Expression of FBXL20 in Refractory Epilepsy Patients and a Pilocarpine-Induced Rat Model. | ||
Neurochem Int Effects of exercise-induced fatigue on the morphology of asymmetric synapse and synaptic protein levels in rat striatum. | ||
Exp Neurol Gene knockout of RNA binding motif 5 in the brain alters RIMS2 protein homeostasis in the cerebellum and Hippocampus and exacerbates behavioral deficits after a TBI in mice | ||
Sci Adv Phosphorylation of Doc2 by EphB2 modulates Munc13-mediated SNARE complex assembly and neurotransmitter release |







