Tested Applications
Positive WB detected in | HeLa cells, Jurkat cells |
Positive IP detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 5 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
16121-1-AP targets RLIM in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9077 Product name: Recombinant human RLIM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 276-350 aa of BC013357 Sequence: SGPELLSRGLFAASGTRNASQGAGSSDTAASGESTGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQTP Predict reactive species |
Full Name | ring finger protein, LIM domain interacting |
Calculated Molecular Weight | 624 aa, 69 kDa |
Observed Molecular Weight | 75 kDa |
GenBank Accession Number | BC013357 |
Gene Symbol | RLIM |
Gene ID (NCBI) | 51132 |
RRID | AB_2181967 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NVW2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RLIM (RING finger LIM domain-binding protein), also known as RNF12 (RING finger protein 12) or NY-REN-43, is a 624 amino acid RING-H2 zinc finger protein that is involved in protein ubiquitinylation and subsequent degradation. Expressed in a variety of tissues, RLIM binds to the LIM domain of various proteins and functions as a protein ligase that negatively co-regulates LIM homeodomain (LIM-HD) transcription factors. Through its interaction with Sin3A, a component of the histone deacetylase corepressor complex, RLIM is able to recruit the corepressor complex to LIM-HD proteins, thereby inhibiting LIM-HD transcription. In addition to recruiting the deacetylase complex to LIM-HD proteins, RLIM is able to bind to, ubiquinate and subsequently degrade CLIM proteins, which function as positive co-regulators of LIM-HD transcription factors. RLIM contains one RING-type zinc finger and is implicated in renal cell carcinoma. The calcualted molecular weight of RLIM is 69 kDa, but modified RLIM is about 70-75 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RLIM antibody 16121-1-AP | Download protocol |
IP protocol for RLIM antibody 16121-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Death Dis RNF12 is regulated by AKT phosphorylation and promotes TGF-β driven breast cancer metastasis. | ||
Oncotarget PIWIL1 destabilizes microtubule by suppressing phosphorylation at Ser16 and RLIM-mediated degradation of Stathmin1. | ||
J Mol Cell Biol Sequential stabilization of RNF220 by RLIM and ZC4H2 during cerebellum development and Shh-group medulloblastoma progression.
| ||
Nat Cell Biol Phase separation of ERCC6L2-CtIP regulates the extent of DNA end resection
|