Home
Products
Primary Antibodies
RNF144B/IBRDC2 Polyclonal antibody (26306-1-AP)

RNF144B/IBRDC2 Polyclonal antibody

RNF144B/IBRDC2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 26306-1-AP

Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, CoIP, ELISA

Synonyms

IBRDC2, RNF144B, E3 ubiquitin-protein ligase RNF144B, EC:2.3.2.31, IBR domain-containing protein 2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHC

WB analysis of HeLa using 26306-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 26306-1-AP (RNF144B/IBRDC2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HeLa using 26306-1-AP
IP result of anti-RNF144B/IBRDC2 (IP:26306-1-AP, 4ug; Detection:26306-1-AP 1:300) with HeLa cells lysate 2400ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 26306-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26306-1-AP (RNF144B/IBRDC2 antibody at dilution of 1:200 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 26306-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26306-1-AP (RNF144B/IBRDC2 antibody at dilution of 1:200 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 26306-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26306-1-AP (RNF144B/IBRDC2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 26306-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26306-1-AP (RNF144B/IBRDC2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse adrenal gland using 26306-1-AP
Immunohistochemical analysis of paraffin-embedded mouse adrenal gland tissue slide using 26306-1-AP (RNF144B/IBRDC2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat adrenal gland using 26306-1-AP
Immunohistochemical analysis of paraffin-embedded rat adrenal gland tissue slide using 26306-1-AP (RNF144B/IBRDC2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells
Positive IP detected in	HeLa cells
Positive IHC detected in	human kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26306-1-AP targets RNF144B/IBRDC2 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag23679 Product name: Recombinant human RNF144B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 123-187 aa of BC063311 Sequence: VADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAE Predict reactive species
Full Name	ring finger protein 144B
Observed Molecular Weight	34 kDa
GenBank Accession Number	BC063311
Gene Symbol	RNF144B
Gene ID (NCBI)	255488
RRID	AB_2880473
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q7Z419
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for RNF144B/IBRDC2 antibody 26306-1-AP	Download protocol
IP protocol for RNF144B/IBRDC2 antibody 26306-1-AP	Download protocol
WB protocol for RNF144B/IBRDC2 antibody 26306-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB,IP,CoIP	EMBO Rep RNF144B negatively regulates antiviral immunity by targeting MDA5 for autophagic degradation Authors - Guoxiu Li View Article