• Featured Product
  • KD/KO Validated

RRM1 Monoclonal antibody

RRM1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA
Cat No. 60073-2-Ig
Clone No.5H6F3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

RIR1, ribonucleotide reductase M1, Ribonucleoside-diphosphate reductase subunit M1, Ribonucleoside-diphosphate reductase large subunit, EC:1.17.4.1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, HeLa cells
Positive IP detected inK-562 cells
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue, human lung cancer tissue, human pancreas cancer tissue, human urothelial carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:3000-1:8000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60073-2-Ig targets RRM1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0789

Product name: Recombinant human RRM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 593-792 aa of BC006498

Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS

Predict reactive species
Full Name ribonucleotide reductase M1
Calculated Molecular Weight 90 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC006498
Gene Symbol RRM1
Gene ID (NCBI) 6240
RRIDAB_10597538
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23921
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ribonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival(PMID:17314339).

Protocols

Product Specific Protocols
IF protocol for RRM1 antibody 60073-2-IgDownload protocol
IHC protocol for RRM1 antibody 60073-2-IgDownload protocol
IP protocol for RRM1 antibody 60073-2-IgDownload protocol
WB protocol for RRM1 antibody 60073-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

EMBO Mol Med

PMID: 31950591

Authors - Sean G Rudd
humanIF

Head Neck

ATM, THMS and RRM1 protein expression in nasopharyngeal carcinomas (NPC) treated with curative intent.

Authors - Jenny Jaeeun Ko
humanWB

J Gastrointest Oncol

Abrogation of ARF6 in promoting erastin-induced ferroptosis and mitigating capecitabine resistance in gastric cancer cells.

Authors - Donghua Geng
humanIHC

Oncol Lett

PMID: 28521448

Authors - Toru Aoyama
humanIHC

Zhongguo Fei Ai Za Zhi

[Prognostic Analysis of ERCC1, RRM1 and p53 Expressions in Postoperative Stage I-II Lung Cancer.].

Authors - Huimin Wang
humanWB,IF

Cell Death Discov

Knockdown of RRM1 in tumor cells promotes radio-/chemotherapy induced ferroptosis by regulating p53 ubiquitination and p21-GPX4 signaling axis.

Authors - Yang Gao
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Juan Pablo (Verified Customer) (11-29-2018)

Works great in WB. I treated CGN with shh (1ug/ml) to induce proliferation and I see a nice increase in RRM1 protein. You get a clean band around 90kDa.For Immuno works good at 1:100 dilution. Tested in P7 cerebellum

  • Applications: Western Blot, Immunohistochemistry,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cerebellar granule culture from P7 pups.
RRM1 Antibody Western Blot,Immunohistochemistry, validation (1:1000 dilution) in Cerebellar granule culture from P7 pups. (Cat no:60073-2-Ig)
Loading...
||
New chat Able
正在加载,请稍候...