Tested Applications
| Positive WB detected in | MCF-7 cells |
| Positive IHC detected in | human thyroid cancer tissue, human brain tissue, human heart tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissue, human testis tissue, human thyroid tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 2 publications below |
| IHC | See 3 publications below |
Product Information
14987-1-AP targets S100A13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6971 Product name: Recombinant human S100A13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC000632 Sequence: MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK Predict reactive species |
| Full Name | S100 calcium binding protein A13 |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC000632 |
| Gene Symbol | S100A13 |
| Gene ID (NCBI) | 6284 |
| RRID | AB_2878097 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99584 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for S100A13 antibody 14987-1-AP | Download protocol |
| IHC protocol for S100A13 antibody 14987-1-AP | Download protocol |
| WB protocol for S100A13 antibody 14987-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastroenterology Proteomic characterization identifies clinically relevant subgroups of gastrointestinal stromal tumors | ||
J Oral Pathol Med Systematic screening identifies a TEAD4-S100A13 axis modulating cisplatin sensitivity of oral squamous cell carcinoma cells.
| ||
Front Immunol Identification of a novel immune-related gene signature for prognosis and the tumor microenvironment in patients with uveal melanoma combining single-cell and bulk sequencing data
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Guorong (Verified Customer) (11-22-2022) | No bands were observed. Does not represent the performance in other kind of samples
|















































