Tested Applications
Positive WB detected in | HepG2 cells, human kidney tissue, human liver tissue, SH-SY5Y cells |
Positive IHC detected in | human meningioma tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 2 publications below |
IF | See 1 publications below |
Product Information
17924-1-AP targets S100A5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12342 Product name: Recombinant human S100A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC093955 Sequence: MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK Predict reactive species |
Full Name | S100 calcium binding protein A5 |
Calculated Molecular Weight | 110 aa, 13 kDa |
Observed Molecular Weight | 11 kDa |
GenBank Accession Number | BC093955 |
Gene Symbol | S100A5 |
Gene ID (NCBI) | 6276 |
RRID | AB_2183794 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P33763 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for S100A5 antibody 17924-1-AP | Download protocol |
IHC protocol for S100A5 antibody 17924-1-AP | Download protocol |
IF protocol for S100A5 antibody 17924-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Sci (Weinh) S100A5 Attenuates Efficiency of Anti-PD-L1/PD-1 Immunotherapy by Inhibiting CD8+ T Cell-Mediated Anti-Cancer Immunity in Bladder Carcinoma | ||
Mol Cell Proteomics The Membrane Proteome of Sensory Cilia to the Depth of Olfactory Receptors. |