Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, SH-SY5Y cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human stomach cancer tissue, human liver cancer tissue, human pancreas cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10245-1-AP targets S100A6 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0385 Product name: Recombinant human S100A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC001431 Sequence: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG Predict reactive species |
| Full Name | S100 calcium binding protein A6 |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC001431 |
| Gene Symbol | S100A6 |
| Gene ID (NCBI) | 6277 |
| RRID | AB_2183801 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P06703 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100A6 is also named as calcyclin, prolactin receptor-associated protein (PRA), growth factor-inducible protein 2A9 ir MLN4. It belongs to S100 family of low molecular weight, acidic, calcium-binding proteins which contain two EF-hand calcium binding sites. S100A6 may function as a calcium sensor to activate several processes in the calcium signal transduction pathway of cell growth, proliferation, secretion and exocytosis. The antibody is specific for S100A6.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for S100A6 antibody 10245-1-AP | Download protocol |
| IF protocol for S100A6 antibody 10245-1-AP | Download protocol |
| IHC protocol for S100A6 antibody 10245-1-AP | Download protocol |
| IP protocol for S100A6 antibody 10245-1-AP | Download protocol |
| WB protocol for S100A6 antibody 10245-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-S100A6 Antibody (Cat# 10245-1-AP) has accumulated 26 citations across journals including Cell, Nature Cell Biology, Nature Communications, Science Translational Medicine, Cancer Letters, British Journal of Cancer, Theranostics, iScience, BMC Cancer, FEBS Letters, and others. Research fields span oncology (liver, pancreatic, ovarian, thyroid, gastric, lung, nasopharyngeal cancers), neurology (ALS, brain metastases), cardiology, nephrology, aging, virology (HCV), reproductive biology, and environmental toxicology. Applications include WB, IF, and IHC.
| Species | Application | Title |
|---|---|---|
Cancer Commun (Lond) Candidate therapeutic agents in a newly established triple wild-type mucosal melanoma cell line. | ||
Nat Cell Biol Single-cell reconstruction of the adult human heart during heart failure and recovery reveals the cellular landscape underlying cardiac function. | ||
Nat Commun Ameliorating calcium homeostasis improves longevity and healthspan in progeroid and naturally aged mice. | ||
Sci Transl Med Mutations in the vesicular trafficking protein annexin A11 are associated with amyotrophic lateral sclerosis. | ||
Theranostics WT1+ glomerular parietal epithelial progenitors promote renal proximal tubule regeneration after severe acute kidney injury |
Reviews
What customers say
The single review for 10245-1-AP is from a researcher who used the antibody at a 1:100 dilution for immunohistochemistry on mouse tissue (lot 00128449). They rated it 5 out of 5 stars and described it as a "good quality product." Overall, customer feedback is positive, with no negative comments reported.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (10-02-2025) | Good quality product
|
