Tested Applications
Positive WB detected in | mouse spleen tissue, human blood, human heart tissue, MCF-7 cells, mouse heart tissue, rat heart tissue |
Positive IHC detected in | human breast cancer tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 4 publications below |
IHC | See 8 publications below |
IF | See 6 publications below |
Product Information
14226-1-AP targets S100A9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5465 Product name: Recombinant human S100A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC047681 Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Predict reactive species |
Full Name | S100 calcium binding protein A9 |
Calculated Molecular Weight | 13 kDa |
Observed Molecular Weight | 14 kDa, 28 kDa |
GenBank Accession Number | BC047681 |
Gene Symbol | S100A9 |
Gene ID (NCBI) | 6280 |
RRID | AB_2254232 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P06702 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer (24 kDa) with an S100A8 partner (S100A8/A9), or as a heterotetramer (28 kDa) with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for S100A9 antibody 14226-1-AP | Download protocol |
IHC protocol for S100A9 antibody 14226-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Cancer S100 calcium-binding protein A9 from tumor-associated macrophage enhances cancer stem cell-like properties of hepatocellular carcinoma. | ||
Cell Biosci TRPM8 deficiency attenuates liver fibrosis through S100A9-HNF4α signaling.
| ||
Int J Med Sci Single-cell RNA Sequencing Uncovered the Involvement of an Endothelial Subset in Neutrophil Recruitment in Chemically Induced Rat Pulmonary Inflammation. | ||
J Oncol Downregulation of S100A9 Reverses Cisplatin-Resistance and Inhibits Proliferation and Migration in Hypopharyngeal Carcinoma
| ||
Histol Histopathol Histopathological assessment of calcification and inflammation of calcific aortic valves from patients with and without diabetes mellitus. |