Tested Applications
| Positive WB detected in | HeLa cells, HuH-7 cells, MCF-7 cells, MDA-MB-231 cells, HepG2 cells |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below |
| WB | See 50 publications below |
| IHC | See 10 publications below |
| IF | See 13 publications below |
| IP | See 2 publications below |
Product Information
21180-1-AP targets S1PR2 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15470 Product name: Recombinant human S1PR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-353 aa of BC069598 Sequence: LNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV Predict reactive species |
| Full Name | sphingosine-1-phosphate receptor 2 |
| Calculated Molecular Weight | 353 aa, 39 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | BC069598 |
| Gene Symbol | S1PR2 |
| Gene ID (NCBI) | 9294 |
| RRID | AB_10694573 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95136 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S1PR2 (sphingosine-1-phosphate receptor 2), also known as S1P2 or EDG5, is one of five G-protein-coupled receptors for sphingosine-1-phosphate (S1P), a biologically active metabolic product of sphingolipid (PMID: 18787560). S1P and its receptors have important regulatory functions in normal physiology and disease processes, particularly involving the immune, central nervous, and cardiovascular systems (PMID: 21339489). S1PR2 plays a role in acute vascular inflammation (PMID: 23723450). S1PR2 signaling is implicated in STAT3 activation (PMID: 22606352).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for S1PR2 antibody 21180-1-AP | Download protocol |
| IF protocol for S1PR2 antibody 21180-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastroenterology Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells | ||
Nat Commun Critical role of sphingosine-1-phosphate receptor-2 in the disruption of cerebrovascular integrity in experimental stroke.
| ||
EMBO Mol Med Therapeutic development of group B Streptococcus meningitis by targeting a host cell signaling network involving EGFR.
| ||
Theranostics Endothelial S1pr2 regulates post-ischemic angiogenesis via AKT/eNOS signaling pathway.
| ||
J Transl Med S1PR3 inhibition impairs cell cycle checkpoint via the AKT/WEE1 pathway in oral squamous cell carcinoma |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Edma (Verified Customer) (03-03-2025) | The antibody quite nice in western blot, but I have to test it in other cell types
|







