SAFB Polyclonal antibody

SAFB Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21857-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

SAF B1, SAF B, HSP27 estrogen response element-TATA box-binding protein, HSP27 ERE-TATA-binding protein, HET

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HEK-293 cells, HeLa cells, MCF-7 cells, A431 cells, HCT 116 cells, COLO 320 cells
Positive IHC detected inmouse testis tissue, human testis tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 4 publications below

Product Information

21857-1-AP targets SAFB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16451

Product name: Recombinant human SAFB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 58-213 aa of BC126219

Sequence: MERLKKAIEDEGGNPDEIEITSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFTILQEIEEPSLEPE

Predict reactive species
Full Name scaffold attachment factor B
Calculated Molecular Weight 917 aa, 103 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC126219
Gene Symbol SAFB
Gene ID (NCBI) 6294
RRIDAB_2878928
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15424
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to pre-mRNA processing and transport. hnRNPs also bind heterogeneous nuclear RNA (hnRNA), the transcripts produced by RNA polymerase II. SAFB (scaffold attachment factor B) is a nuclear matrix-associated protein that binds to matrix- or scaffold-associating regions (MARs or SARs) on DNA and interacts with RNA polymerase II and serine-/arginine-rich RNA processing factors (SR proteins). SAFB, also designated HAP (hnRNP A1 associated protein) and HET (HSP 27-ERE-TATA-binding protein) is a proven hnRNP protein that has a speckled distribution in the nucleus and, in response to stress agents such as heat shock, is recruited to a few, large nuclear granules, called perichromatin granules. SAFB also binds to the estrogen receptor (ER) and is expressed in several breast cancer cell lines at varying levels. Subsequently, SAFB may play a role in breast cancer by mediating cellular proliferation and division. This antibody specifically reacts whith the isoform 1 of human SAFB protein. SF3A1, also known as SF3a120, is a 793 amino acid protein, which is a Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. SF3A1 also be involved in the assembly of the 'E' complex. The calculated molecular weight of SAFB is 103 kDa, but the modified SAFB is about 130-175 kDa.(PMID: 28469965, PMID: 26273616 )

Protocols

Product Specific Protocols
IF protocol for SAFB antibody 21857-1-APDownload protocol
IHC protocol for SAFB antibody 21857-1-APDownload protocol
WB protocol for SAFB antibody 21857-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Acta Neuropathol Commun

RBM45 associates with nuclear stress bodies and forms nuclear inclusions during chronic cellular stress and in neurodegenerative diseases.

Authors - Mahlon Collins
humanIF

Neurobiol Dis

ALS-linked cytoplasmic FUS assemblies are compositionally different from physiological stress granules and sequester hnRNPA3, a novel modifier of FUS toxicity.

Authors - Haiyan An
humanIF

Cell Rep

Stress-induced TDP-43 nuclear condensation causes splicing loss of function and STMN2 depletion

Authors - Wan-Ping Huang
mouseIF

Mol Cell

SAFB restricts contact domain boundaries associated with L1 chimeric transcription

Authors - Yaqiang Hong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Moritz (Verified Customer) (09-26-2025)

worked well for the detection of mouse safb protein

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: mESCs
SAFB Antibody Western Blot validation (1:5000 dilution) in mESCs (Cat no:21857-1-AP)
FH

Aleksandr (Verified Customer) (12-16-2024)

Antibody does recognise the band of the expected molecular weight of SafB protein, however other non-specific bands are also visible

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: RKO
SAFB Antibody Western Blot validation (1:1000 dilution) in RKO (Cat no:21857-1-AP)
FH

Tsimafei (Verified Customer) (11-19-2024)

Antibody detect a band below 150 kDa in HEK293T cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
SAFB Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:21857-1-AP)
FH

Izortze (Verified Customer) (10-02-2024)

Great antibody for immunoprecipitation!

  • Applications: Immunoprecipitation
  • Cell Tissue Type: EndoCb-H1 cell line
SAFB Antibody Immunoprecipitation validation ( dilution) in EndoCb-H1 cell line (Cat no:21857-1-AP)
FH

Julia (Verified Customer) (08-07-2024)

Used antibody for mESC protein extract. Band of the correct size is visible, additional band at ~75kDa. Stains ladder but otherwise good.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: mESC
SAFB Antibody Western Blot validation (1:5000 dilution) in mESC (Cat no:21857-1-AP)
FH

Tatyana (Verified Customer) (12-04-2023)

Good signal in ICC, can be used to detect nuclear stress bodies (nSBs)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human / HeLa cells
SAFB Antibody Immunofluorescence validation (1:1000 dilution) in Human / HeLa cells (Cat no:21857-1-AP)
FH

Bibha (Verified Customer) (06-05-2019)

I used this antibody in human primary astrocytes Mock-infected or infected with Venezuelan equine encephalitis virus.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human primary astrocytes
SAFB Antibody Western Blot, validation (1:1000 dilution) in Human primary astrocytes (Cat no:21857-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...