Tested Applications
| Positive WB detected in | HEK-293 cells, mouse testis tissue, K-562 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25544-1-AP targets SCML2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22271 Product name: Recombinant human SCML2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 563-649 aa of BC064617 Sequence: MYIHTSVSQDFSRSVPGTTSSPLVGDISPKSSPHEVKFQMQRKSEAPSYIAVPDPSVLKQGFSKDPSTWSVDEVIQFMKHTDPQISG Predict reactive species |
| Full Name | sex comb on midleg-like 2 (Drosophila) |
| Calculated Molecular Weight | 700 aa, 77 kDa |
| Observed Molecular Weight | 70 kDa, 80 kDa |
| GenBank Accession Number | BC064617 |
| Gene Symbol | SCML2 |
| Gene ID (NCBI) | 10389 |
| RRID | AB_2880127 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UQR0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The human SCML2 gene, a mammalian homologue of the Drosophila PcG protein SCM, encodes two protein isoforms: SCML2A that is bound to chromatin and SCML2B that is predominantly nucleoplasmic (PMID: 24358021). Polycomb repressive complex-1 (PRC1) is essential for the epigenetic regulation of gene expression. SCML2 is a Polycomb-group protein that associates with PRC1. SCML2 participates in the epigenetic control of transcription directly and in cooperation with PRC1 (PMID: 24986859).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SCML2 antibody 25544-1-AP | Download protocol |
| IP protocol for SCML2 antibody 25544-1-AP | Download protocol |
| WB protocol for SCML2 antibody 25544-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









