Tested Applications
| Positive WB detected in | mouse colon tissue, human liver tissue, mouse brain tissue, mouse heart tissue, rat colon tissue |
| Positive IHC detected in | human breast cancer tissue, human gliomas tissue, rat colon tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10407-1-AP targets Syntenin 2 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0668 Product name: Recombinant human SDCBP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC002727 Sequence: MVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA Predict reactive species |
| Full Name | syndecan binding protein (syntenin) 2 |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 35-37 kDa |
| GenBank Accession Number | BC002727 |
| Gene Symbol | Syntenin 2 |
| Gene ID (NCBI) | 27111 |
| RRID | AB_2183161 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H190 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Syndecan-binding protein 2 (SDCBP2, Syntenin 2) is a protein containing two PDZ domains. PDZ domains facilitate protein-protein interactions by binding to the cytoplasmic C-terminus of transmembrane proteins. SDCBP2 binds with high affinity to PIP2 and is targeted to the plasma membrane, nucleoli and nuclear speckles via its PDZ domains (PMID: 15961997). SDCBP2 exists in two alternatively spliced variants, 2α and 2β, which differ in the lengths of their N-terminal regions. (PMID: 15276154)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Syntenin 2 antibody 10407-1-AP | Download protocol |
| WB protocol for Syntenin 2 antibody 10407-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-SDCBP2 antibody (Cat# 10407-1-AP) has 6 total citations. These appear in Frontiers in Immunology, Frontiers in Microbiology, Gut Pathogens, Cell Signaling, Journal of Virology, and Frontiers in Neuroscience. Research fields span lung adenocarcinoma ferroptosis, HPV virology, pediatric pneumonia, acute myeloid leukemia, and Alzheimer's disease. Applications include WB, IHC, IF, and CoIP in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Front Immunol SDCBP2 promotes tumor progression and is a novel ferroptosis-related prognostic biomarker in lung adenocarcinoma.
| ||
Front Microbiol HPV8-E6 Interferes with Syntenin-2 Expression through Deregulation of Differentiation, Methylation and Phosphatidylinositide-Kinase Dependent Mechanisms.
| ||
Gut Pathog Virulence factors and mechanisms of paediatric pneumonia caused by Enterococcus faecalis | ||
J Virol Human papillomavirus type 8 E6 oncoprotein inhibits transcription of the PDZ protein syntenin-2. | ||
Front Neurosci MiR-409-5p as a Regulator of Neurite Growth Is Down Regulated in APP/PS1 Murine Model of Alzheimer's Disease.
|
Reviews
What customers say
One reviewer (Kamal Baral) gave this antibody a 5-star rating in February 2024. They used it for Western Blot on mouse liver tissue lysates at a 1:2000 dilution with overnight incubation at 4°C. The antibody successfully detected Syntenin 2 at the expected 36 kDa molecular weight, indicating reliable performance and correct specificity under these conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kamal (Verified Customer) (02-15-2024) | Mouse liver tissue lysates were subjected to SDS PAGE followed by western blot with this antibody at dilution of 1:2000 incubated at 4 degree overnight. Syntenin 2 appeared at 36 kDa.
|
