Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17913-1-AP targets SEC31A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12314 Product name: Recombinant human SEC31A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 758-1106 aa of BC084583 Sequence: AAQGSIAAALAFLPDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPPPGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQRPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSETSAFMPVLKVVLTQANKLGV Predict reactive species |
| Full Name | SEC31 homolog A (S. cerevisiae) |
| Calculated Molecular Weight | 1220 aa, 133 kDa |
| Observed Molecular Weight | 118-140 kDa |
| GenBank Accession Number | BC084583 |
| Gene Symbol | SEC31A |
| Gene ID (NCBI) | 22872 |
| RRID | AB_2186378 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O94979 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COPII-coated vesicles mediate anterograde transport from the ER to the Golgi apparatus. COPII is composed of three parts: two coat protein complexes (Sec23/24 complex and Sec13/31 complex) and one small GTP-binding protein, Sar1 (PMID: 9568718). The sec31 subunit of the coat complex has been shown to be essential for vesicle formation and ER-Golgi transport (PMID: 10788476). Two mammalian homologues of yeast sec31p, Sec31A and Sec31B, share about 40% amino acid identity. Sec31A transcripts are ubiquitously and abundantly expressed.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SEC31A antibody 17913-1-AP | Download protocol |
| IHC protocol for SEC31A antibody 17913-1-AP | Download protocol |
| IP protocol for SEC31A antibody 17913-1-AP | Download protocol |
| WB protocol for SEC31A antibody 17913-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
SEC31A polyclonal antibody (Cat# 17913-1-AP) has 22 citations in journals including Nature (×3), Cell, Nat Cell Biol, Mol Cell, EMBO J, J Clin Invest, Dev Cell, J Cell Biol, Neurobiol Dis (×2), J Biol Chem (×2), Adv Sci, Cell Death Dis, PLoS Biol, and others. Research fields span COPII vesicle transport, ER-to-Golgi trafficking, lipid homeostasis, antiviral immunity, neurodegeneration, and cardiovascular disease.
| Species | Application | Title |
|---|---|---|
Nature CRISPR screens unveil signal hubs for nutrient licensing of T cell immunity.
| ||
Cell Small Molecule Targets TMED9 and Promotes Lysosomal Degradation to Reverse Proteinopathy. | ||
Nat Cell Biol Manganese regulation of COPII condensation controls circulating lipid homeostasis | ||
Redox Biol Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis |
Reviews
What customers say
Users report consistent high performance across applications. For Western Blot, one reviewer noted a strong band at the expected molecular weight (5/5), while another described the result as "clean, excellent and specific" at 1:500 dilution on mouse tail tendon protein (4/5). For Immunofluorescence on Cos-7 cells at 1:300 dilution, the antibody labeled intracellular vesicles with clear contrast (5/5). Overall, reviewers highlight specificity, clean signals, and reliable performance in both WB and IF.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boyan (Verified Customer) (09-01-2020) | This antibody labels a strong band around the expected molecular weight.
|
RICHA (Verified Customer) (09-29-2019) | Clean, excellent and specific
 |
Rui (Verified Customer) (09-28-2019) | Labels intracellular vesicles with clear contrast. Cell monolayer fixed by 0.3% glutaraldehyde and 3% paraformaldehyde. Permeabilization: 0.1% saponin and 3% BSA in PBS. Primary antibody overnight at 4C.
 |
