Tested Applications
Positive WB detected in | rat testis tissue, mouse testis tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
24590-1-AP targets Septin 14 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20181 Product name: Recombinant human SEPT14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 389-432 aa of BC153166 Sequence: IRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHRKK Predict reactive species |
Full Name | septin 14 |
Calculated Molecular Weight | 432 aa, 50 kDa |
Observed Molecular Weight | 50 kDa |
GenBank Accession Number | BC153166 |
Gene Symbol | Septin 14 |
Gene ID (NCBI) | 346288 |
RRID | AB_2879626 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6ZU15 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Septin 14 antibody 24590-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Death Dis TMEM232 is required for the formation of sperm flagellum and male fertility in mice |