Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SETD8 Polyclonal antibody

SETD8 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14063-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, CoIP, ChIP, ELISA, Cell treatment

KMT5A, Pr SET 7, EC:2.1.1.-, EC:2.1.1.361, H4-K20-HMTase KMT5A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, RAW 264.7 cells, HepG2 cells, A549 cells, NIH/3T3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14063-1-AP targets SETD8 in WB, IHC, IF, IP, CoIP, ChIP, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5114

Product name: Recombinant human SETD8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-352 aa of BC050346

Sequence: MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVRHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

Predict reactive species
Full Name SET domain containing (lysine methyltransferase) 8
Calculated Molecular Weight 43 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC050346
Gene Symbol SETD8
Gene ID (NCBI) 387893
RRIDAB_2878006
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NQR1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SETD8, also known as Set8, PR-Set7, or KMT5A, is a member of the SET domain family of histone lysine methyltransferases and, to date, the only known enzyme that catalyzes monomethylation of H4K20 in eukaryotes, which is involved in DNA damage response, mitotic condensation, and DNA replication. SETD8 is overexpressed in various types of tumors, such as bladder cancer, non-small cell lung carcinoma, and small cell lung carcinoma, and is associated with a shorter survival time for gastric, esophageal, and prostate cancer patients.

Protocols

Product Specific Protocols
FC protocol for SETD8 antibody 14063-1-APDownload protocol
IHC protocol for SETD8 antibody 14063-1-APDownload protocol
IP protocol for SETD8 antibody 14063-1-APDownload protocol
WB protocol for SETD8 antibody 14063-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Cell Death Differ

NAT10 regulates heart development and function by maintaining the expression of genes related to fatty acid β-oxidation and heart contraction

Authors - Lei Shi
ratWB,IF

Mol Cell Proteomics

Temporal Proteomic Analysis of Pancreatic β-Cells in Response to Lipotoxicity and Glucolipotoxicity.

Authors - Zonghong Li
humanWB,IHC

Cancer Lett

SETD8 potentiates constitutive ERK1/2 activation via epigenetically silencing DUSP10 expression in pancreatic cancer.

Authors - Mengqi Liu
humanWB,IF,CoIP

Oxid Med Cell Longev

Fasting Induces Hepatocellular Carcinoma Cell Apoptosis by Inhibiting SET8 Expression.

Authors - Jie Qi
  • KD Validated
rat,humanWB,IHC,IF

Exp Mol Med

SET8 suppression mediates high glucose-induced vascular endothelial inflammation via the upregulation of PTEN.

Authors - Xuefang Shen
  • KD Validated
humanWB

Cell Biosci

DDB2 regulates DNA replication through PCNA-independent degradation of CDT2.

Authors - Xiaojun Wu
Loading...
||
New chat

Able

正在加载,请稍候...