Tested Applications
Positive WB detected in | mouse kidney tissue |
Positive IP detected in | mouse kidney tissue |
Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
Product Information
24327-1-AP targets SGLT3/SLC5A4 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19391 Product name: Recombinant human SLC5A4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 579-633 aa of BC153069 Sequence: SQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDTSER Predict reactive species |
Full Name | solute carrier family 5 (low affinity glucose cotransporter), member 4 |
Calculated Molecular Weight | 659 aa, 72 kDa |
Observed Molecular Weight | 60-70 kDa |
GenBank Accession Number | BC153069 |
Gene Symbol | SGLT3 |
Gene ID (NCBI) | 6527 |
RRID | AB_2650519 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NY91 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC5A4, also known as SGLT3, is a sugar sensor that depolarizes the plasma membrane in response to external glucose (PMID: 12748858, 20421923). SGLT3 mediates the influx of sodium ions into the cell but does not transport sugars, also potently activated by imino sugars such as deoxynojirimycin (PMID: 22766068, 13130073). SGLT3 is a plasma membrane protein, shares 70% identity with SGLT1, and is expressed in the small intestine (cholinergic neurons), skeletal muscle, kidney, uterus, and testis (PMID: 12748858). SGLT3 protein at apparent molecular masses of 72 kDa and 80 kDa in human kidney tissue and HK-2 cells (PMID: 22766068).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SGLT3/SLC5A4 antibody 24327-1-AP | Download protocol |
IHC protocol for SGLT3/SLC5A4 antibody 24327-1-AP | Download protocol |
IP protocol for SGLT3/SLC5A4 antibody 24327-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Environ Res Public Health Involvement of Intestinal Goblet Cells and Changes in Sodium Glucose Transporters Expression: Possible Therapeutic Targets in Autistic BTBR T+Itpr3tf/J Mice. | ||
Life Sci Intestinal sodium/glucose cotransporter 3 expression is epithelial and downregulated in obesity. | ||
PLoS One Sweat glucose and GLUT2 expression in atopic dermatitis: Implication for clinical manifestation and treatment. |