Tested Applications
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| FC | See 4 publications below |
| CoIP | See 1 publications below |
Product Information
11871-1-AP targets SH2D1B in IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2454 Product name: Recombinant human SH2D1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC022407 Sequence: MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP Predict reactive species |
| Full Name | SH2 domain containing 1B |
| Calculated Molecular Weight | 132 aa, 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC022407 |
| Gene Symbol | SH2D1B |
| Gene ID (NCBI) | 117157 |
| RRID | AB_10603473 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14796 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SH2D1B, also named as EAT2, an adaptor expressed in innate immune cells, including natural killer (NK) cells. It plays a role in controlling signal transduction through at least four receptors, CD84, SLAMF1, LY9 and CD244, expressed on the surface of professional antigen-presenting cells. EAT-2 overexpression would enhance the innate immune responses and also result in more potent Carcinoembryonic antigen-specific adaptive immune responses.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SH2D1B antibody 11871-1-AP | Download protocol |
| IHC protocol for SH2D1B antibody 11871-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Immunity Cytomegalovirus infection drives adaptive epigenetic diversification of NK cells with altered signaling and effector function. | ||
Immunity Epigenetic modification and antibody-dependent expansion of memory-like NK cells in human cytomegalovirus-infected individuals. | ||
Mol Ther Anti-NKG2C/IL-15/anti-CD33 Killer Engager Directs Primary and iPSC-derived NKG2C+ NK cells to Specifically Target Myeloid Leukemia. | ||
J Immunol Systemic Lupus Erythematosus Immune Complexes Increase the Expression of SLAM Family Members CD319 (CRACC) and CD229 (LY-9) on Plasmacytoid Dendritic Cells and CD319 on CD56dim NK Cells. | ||
J Immunol T Cells Regulate Peripheral Naive Mature B Cell Survival by Cell-Cell Contact Mediated through SLAMF6 and SAP. |





