Tested Applications
Positive WB detected in | PC-3 cells, U-251 cells |
Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
12210-1-AP targets SH3BGRL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2857 Product name: Recombinant human SH3BGRL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC030135 Sequence: MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA Predict reactive species |
Full Name | SH3 domain binding glutamic acid-rich protein like 3 |
Calculated Molecular Weight | 93 aa, 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC030135 |
Gene Symbol | SH3BGRL3 |
Gene ID (NCBI) | 83442 |
RRID | AB_10694666 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H299 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SH3BGRL3, SH3 domain-binding glutamic acid-rich-like protein, could act as a modulator of glutaredoxin biological activity. It may play a role in cytoskeleton organization (PMID: 34380438). SH3BGRL3 acts as a potential prognostic biomarker for urothelial carcinoma and a novel binding partner of epidermal growth factor receptor (PMID: 26286913).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SH3BGRL3 antibody 12210-1-AP | Download protocol |
IHC protocol for SH3BGRL3 antibody 12210-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |