Tested Applications
Positive WB detected in | rat brain tissue, mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
27014-1-AP targets SH3GL1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25550 Product name: Recombinant human SH3GL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 233-313 aa of BC001270 Sequence: LDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKA Predict reactive species |
Full Name | SH3-domain GRB2-like 1 |
Calculated Molecular Weight | 41 kDa |
Observed Molecular Weight | 41-43 kDa |
GenBank Accession Number | BC001270 |
Gene Symbol | SH3GL1 |
Gene ID (NCBI) | 6455 |
RRID | AB_2880722 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q99961 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SH3GL1 antibody 27014-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Cell Sci Tubular microdomains of Rab7-positive endosomes retrieve TrkA, a mechanism disrupted in Charcot-Marie-Tooth disease 2B. | ||