Tested Applications
| Positive WB detected in | HeLa cells, human testis tissue, mouse lung tissue, mouse testis tissue, rat lung tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IF | See 1 publications below |
Product Information
15897-1-AP targets SH3GLB2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8712 Product name: Recombinant human SH3GLB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-395 aa of BC014635 Sequence: MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS Predict reactive species |
| Full Name | SH3-domain GRB2-like endophilin B2 |
| Calculated Molecular Weight | 395 aa, 44 kDa |
| Observed Molecular Weight | 47-50 kDa |
| GenBank Accession Number | BC014635 |
| Gene Symbol | SH3GLB2 |
| Gene ID (NCBI) | 56904 |
| RRID | AB_2187269 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NR46 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SH3GLB2 is an endophilin-related protein family with 395-amino acid protein and contains an N-terminal domain, a central coiled-coil region, and a C-terminal SH3 domain. SH3GLB2 is expressed in many tissues, including skeletal muscle, adipocytes, brain, lung, colon, and mammary gland. SH3GLB2 was expressed in the cytoplasm of transfected HeLa cells and was excluded from nuclei(PMID: 11161816).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SH3GLB2 antibody 15897-1-AP | Download protocol |
| IHC protocol for SH3GLB2 antibody 15897-1-AP | Download protocol |
| IP protocol for SH3GLB2 antibody 15897-1-AP | Download protocol |
| WB protocol for SH3GLB2 antibody 15897-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Brain Pathol Neuronal Susceptibility to Beta-Amyloid Toxicity and Ischemic Injury Involves Histone Deacetylase-2 Regulation of Endophilin-B1. | ||
J Biol Chem Endophilin B2 facilitates endosome maturation in response to growth factor stimulation, autophagy induction, and influenza A virus infection.
|



















