• Featured Product
  • KD/KO Validated

SHCBP1 Polyclonal antibody

SHCBP1 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 12672-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

PAL, SHCBP1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, Sp2/0 cells, Neuro-2a cells, HepG2 cells, mouse thymus tissue
Positive IP detected inJurkat cells
Positive IHC detected inhuman liver cancer tissue, human tonsillitis tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12672-1-AP targets SHCBP1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3355

Product name: Recombinant human SHCBP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 374-672 aa of BC030699

Sequence: NACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKGDTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGAGIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQESAEDGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF

Predict reactive species
Full Name SHC SH2-domain binding protein 1
Calculated Molecular Weight 672 aa, 76 kDa
Observed Molecular Weight 75-85 kDa
GenBank Accession NumberBC030699
Gene Symbol SHCBP1
Gene ID (NCBI) 79801
RRIDAB_10639526
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NEM2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SHCBP1 was initially identified as a potential gene associated with cell proliferation in fibroblasts. SHCBP1 exerts a crucial physiological function in normal tissue development. Chen et al. showed that SHCBP1 is an essential component of FGF signaling in neural progenitor cells. SHCBP1 is also upregulated during T cell proliferation and regulates CD4+ T cell effector function in vivo. Recently, SHCBP1 was shown to be closely associated with cancer development.

Protocols

Product Specific Protocols
IHC protocol for SHCBP1 antibody 12672-1-APDownload protocol
IP protocol for SHCBP1 antibody 12672-1-APDownload protocol
WB protocol for SHCBP1 antibody 12672-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Neurosci

Impaired neurogenesis alters brain biomechanics in a neuroprogenitor-based genetic subtype of congenital hydrocephalus.

Authors - Phan Q Duy
humanWB,IF,IP

Genomics

SHCBP1 interacting with EOGT enhances O-GlcNAcylation of NOTCH1 and promotes the development of pancreatic cancer.

Authors - Can Yang
  • KD Validated
humanWB,IHC

Am J Cancer Res

SHCBP1 regulates STAT3/c-Myc signaling activation to promote tumor progression in penile cancer.

Authors - Miao Mo
  • KD Validated
humanWB

J Virol

Measles virus non-structural C protein modulates viral RNA polymerase activity by interacting with a host protein SHCBP1.

Authors - Ito Minako M
  • KD Validated
mouseWB

Mol Carcinog

Knockout of Shcbp1 sensitizes immunotherapy by regulating α-SMA positive cancer-associated fibroblasts

Authors - Qianlin Gu
  • KO Validated
humanIF,IHC, WB

J Exp Clin Cancer Res

SHCBP1 promotes synovial sarcoma cell metastasis via targeting TGF-β1/Smad signaling pathway and is associated with poor prognosis.

Authors - Changliang Peng
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...