Tested Applications
| Positive WB detected in | SH-SY5Y cells, HEK-293 cells, MCF-7 cells, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22432-1-AP targets SIKE1 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18196 Product name: Recombinant human SIKE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 108-207 aa of BC005934 Sequence: YRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMDTASQAIK Predict reactive species |
| Full Name | suppressor of IKK epsilon |
| Calculated Molecular Weight | 207 aa, 24 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC005934 |
| Gene Symbol | SIKE1 |
| Gene ID (NCBI) | 80143 |
| RRID | AB_10914502 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BRV8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SIKE1 antibody 22432-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







