Tested Applications
| Positive WB detected in | Raji cells, HEK-293T cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26793-1-AP targets SIPA1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25383 Product name: Recombinant human SIPA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 950-1042 aa of BC010492 Sequence: GQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA Predict reactive species |
| Full Name | signal-induced proliferation-associated 1 |
| Calculated Molecular Weight | 1042 aa, 112 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC010492 |
| Gene Symbol | SIPA1 |
| Gene ID (NCBI) | 6494 |
| RRID | AB_2880637 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96FS4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SIPA1 (Signal-induced proliferation-associated protein 1) is also named as SPA1, p130 SPA-1 and GTPase-activating protein Spa-1. SIPA1, a GTPase activating protein, was discovered in proliferating lymphocytes as mitogen-induced nuclear protein. SIPA1 promotes catalyzation of hydrolyze Rap1GTP/GDP and is known to be a negative regulator of Ras-related protein, which transduces the signals for various cellular functions, including development, cellular proliferation, and cellular adhesion (PMID:28237246). Transcription of fibronectin 1, which is crucial for cell junction and migration of triple-negative breast cancer (TNBC) cells, was regulated by SIPA1 in a DBR-dependent manner. SIPA1 was highly expressed in metastatic TNBC. SIPA1 served as a TF, promoting TNBC migration, invasion, and metastasis (PMID: 37500797).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SIPA1 antibody 26793-1-AP | Download protocol |
| WB protocol for SIPA1 antibody 26793-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Transl Oncol Identification of metastasis-associated exoDEPs in colorectal cancer using label-free proteomics. | ||
Mol Cell Proteomics Characterization of Usher Syndrome Type 2-Associated Proteins in the Retina via Affinity Purification-Mass Spectrometry. | ||
Cancer Lett A TRIM21-UCHL3-ITCH-SIPA1 axis promotes colorectal cancer growth and metastasis.
|



















