SLAMF7/CD319 Polyclonal antibody

SLAMF7/CD319 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 12905-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (1)

Applications

WB, IHC, IF, ELISA

SLAMF7, Membrane protein FOAP-12, FOAP-12, CS1, CRACC

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inIM-9 cells, human spleen tissue, pig spleen tissue, Jurkat cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12905-1-AP targets SLAMF7/CD319 in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3804

Product name: Recombinant human SLAMF7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-227 aa of BC027867

Sequence: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMV

Predict reactive species
Full Name SLAM family member 7
Calculated Molecular Weight 335 aa, 37 kDa
Observed Molecular Weight 66 kDa
GenBank Accession NumberBC027867
Gene Symbol SLAMF7
Gene ID (NCBI) 57823
RRIDAB_2239192
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NQ25
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Signaling lymphocyte activation molecule (SLAM) family receptors is a group of type I transmembrane receptors belonging to the immunoglobulin superfamily (PMID: 37251372). The SLAM family contains nine members that contain an extracellular segment comprising two or four Ig-like domains (V-like variable and C2-like constant), a transmembrane region and a cytoplasmic tail (PMID: 29662641). They are involved in various physiological and pathological processes, including the regulation of immunological responses and the route of viral entry. SLAMF7, also known as CS1, CRACC or CD319, is expressed on NK cells, CD8+ T lymphocytes, B lymphocytes, and mature dendritic cells (PMID: 28861320). It exerts both activating and inhibitory effects depending on the expression status of SAP or EAT-2. SLAMF7 is overexpressed in multiple myeloma and makes it a target for immunotherapy (PMID: 28861320). The native molecular weight of SLAMF7 is 37 kDa and the apparent molecular mass shifts due to glycosylation (PMID: 11698418; 36381324).

Protocols

Product Specific Protocols
IHC protocol for SLAMF7/CD319 antibody 12905-1-APDownload protocol
WB protocol for SLAMF7/CD319 antibody 12905-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Int J Chron Obstruct Pulmon Dis

Analysis of Key Genes and miRNA-mRNA Networks Associated with Glucocorticoids Treatment in Chronic Obstructive Pulmonary Disease

Authors - Jian-Jun Wu
mouseWB,IF

Exploration (Beijing)

Bioengineer mesenchymal stem cell for treatment of glioma by IL-12 mediated microenvironment reprogramming and nCD47-SLAMF7 mediated phagocytosis regulation of macrophages

Authors - Man Li
humanWB,IHC

Mol Cell Endocrinol

The lysosome-associated SLAMF7 inhibits the development of ovarian cancer by promoting lysosomal damage

Authors - Wen Zou
Loading...
||
New chat Able
正在加载,请稍候...