Tested Applications
Positive IHC detected in | human kidney tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IHC | See 3 publications below |
Product Information
21722-1-AP targets SLC13A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16379 Product name: Recombinant human SLC13A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 129-231 aa of BC096277 Sequence: MLVTAFLSMWISNTATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASI Predict reactive species |
Full Name | solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 |
Calculated Molecular Weight | 592 aa, 64 kDa |
GenBank Accession Number | BC096277 |
Gene Symbol | SLC13A2 |
Gene ID (NCBI) | 9058 |
RRID | AB_2878912 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13183 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC13A2 (Solute Carrier Family 13 Member 2) is involved in the transport of citric acid cycle intermediates, such as succinate, citrate, fumarate, and alpha-ketoglutarate (2-oxoglutarate), across cell membranes. In the liver, SLC13A2 has been shown to promote metabolic remodeling by transporting citrate, which is then converted to acetyl-CoA, a precursor for cholesterol synthesis and fatty acid metabolism (PMID: 39824985).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for SLC13A2 antibody 21722-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Am J Physiol Renal Physiol Expression of sodium-dependent dicarboxylate transporter 1 (NaDC1/SLC13A2) in normal and neoplastic human kidney. | ||
Cancer Med Transcriptome analysis in primary colorectal cancer tissues from patients with and without liver metastases using next-generation sequencing. | ||
Am J Physiol Renal Physiol Regulation of Renal NaDC1 Expression and Citrate Excretion by NBCe1-A. | ||
Physiol Rep Effect of NBCe1 deletion on renal citrate and 2-oxoglutarate handling.
|