• Featured Product
  • KD/KO Validated

SLC13A2 Polyclonal antibody

SLC13A2 Polyclonal Antibody for IHC, ELISA
Cat No. 21722-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

SDCT1, NaDC-1, NADC1, NaDC 1, NaCT

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman kidney tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21722-1-AP targets SLC13A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16379

Product name: Recombinant human SLC13A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 129-231 aa of BC096277

Sequence: MLVTAFLSMWISNTATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASI

Predict reactive species
Full Name solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2
Calculated Molecular Weight 592 aa, 64 kDa
GenBank Accession NumberBC096277
Gene Symbol SLC13A2
Gene ID (NCBI) 9058
RRIDAB_2878912
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13183
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC13A2 (Solute Carrier Family 13 Member 2) is involved in the transport of citric acid cycle intermediates, such as succinate, citrate, fumarate, and alpha-ketoglutarate (2-oxoglutarate), across cell membranes. In the liver, SLC13A2 has been shown to promote metabolic remodeling by transporting citrate, which is then converted to acetyl-CoA, a precursor for cholesterol synthesis and fatty acid metabolism (PMID: 39824985).

Protocols

Product Specific Protocols
IHC protocol for SLC13A2 antibody 21722-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Am J Physiol Renal Physiol

Expression of sodium-dependent dicarboxylate transporter 1 (NaDC1/SLC13A2) in normal and neoplastic human kidney.

Authors - Hyun-Wook Lee
humanIHC

Cancer Med

Transcriptome analysis in primary colorectal cancer tissues from patients with and without liver metastases using next-generation sequencing.

Authors - Sen Wang
mouse

Am J Physiol Renal Physiol

Regulation of Renal NaDC1 Expression and Citrate Excretion by NBCe1-A.

Authors - Gunars Osis
mouseIHC

Physiol Rep

Effect of NBCe1 deletion on renal citrate and 2-oxoglutarate handling.

Authors - Gunars Osis
  • KO Validated
Loading...
||
New chat Able
正在加载,请稍候...