Tested Applications
| Positive WB detected in | mouse kidney tissue, HEK-293 cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26182-1-AP targets SLC13A3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24183 Product name: Recombinant human SLC13A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 568-602 aa of BC035966 Sequence: QTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL Predict reactive species |
| Full Name | solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 |
| Calculated Molecular Weight | 602 aa, 67 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC035966 |
| Gene Symbol | SLC13A3 |
| Gene ID (NCBI) | 64849 |
| RRID | AB_2880414 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WWT9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC13A3, also named NADC3 and SDCT2, belongs to the SLC13A/DASS transporter (TC 2.A.47) family and NADC subfamily. SLC13A3 encodes the plasma membrane Na+ /Dicarboxylate Cotransporter 3 (NaDC3), which imports inside the cell four to six carbon dicarboxylates as well as N-acetylaspartate (NAA). SLC13A3 is mainly expressed in kidney, but also in brain, liver, placenta and eye (PMID: 30635937). This antibody detected the 55-60 kDa band in SDS-PAGE. However, the 55 kDa (nonglycosylated) and 85 kDa (glycosylated) bands have been reported in the article (PMID: 27053689).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC13A3 antibody 26182-1-AP | Download protocol |
| WB protocol for SLC13A3 antibody 26182-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Int J Mol Sci Succinate Accumulation Is Associated with a Shift of Mitochondrial Respiratory Control and HIF-1α Upregulation in PTEN Negative Prostate Cancer Cells. | ||
Cell Metab Adipocyte-derived glutathione promotes obesity-related breast cancer by regulating the SCARB2-ARF1-mTORC1 complex |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joo-Seop (Verified Customer) (07-23-2025) | It marks a subset of proximal tubules in the mouse kidney at P9.
![]() |








