Tested Applications
Positive WB detected in | HEK-293 cells, A549 cells, C6 cells, HeLa cells, HepG2 cells |
Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
20340-1-AP targets SLC18A1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14131 Product name: Recombinant human SLC18A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 43-138 aa of BC009387 Sequence: PIVPTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITR Predict reactive species |
Full Name | solute carrier family 18 (vesicular monoamine), member 1 |
Calculated Molecular Weight | 525 aa, 56 kDa |
Observed Molecular Weight | 50 kDa, 56 kDa |
GenBank Accession Number | BC009387 |
Gene Symbol | SLC18A1 |
Gene ID (NCBI) | 6570 |
RRID | AB_10666128 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P54219 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC18A1 antibody 20340-1-AP | Download protocol |
IHC protocol for SLC18A1 antibody 20340-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |