Tested Applications
| Positive WB detected in | A375 cells |
| Positive IF-Fro detected in | mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
Product Information
12876-1-AP targets EAAT4 in WB, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3554 Product name: Recombinant human SLC1A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 149-271 aa of BC028721 Sequence: MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL Predict reactive species |
| Full Name | solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6 |
| Calculated Molecular Weight | 61.6 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC028721 |
| Gene Symbol | EAAT4 |
| Gene ID (NCBI) | 6511 |
| RRID | AB_10642147 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48664 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Excitatory amino acid transporter 4 (EAAT4) is a neuronal glutamate transporter responsible for the reuptake of synaptically released glutamate. The EAAT4 protein is highly enriched in Purkinje cells of the cerebellum, although it is not restricted to these cells (18770868). While the predicted molecular weight of EAAT4 is 62 kDa, considerable heterogeneity in transporter size has been reported in the brain with molecular weights ranging from 50 to 120 kDa as a result of differential glycosylation and/or phosphorylation (24056007). This antibody recognizes 60-70 kDa of EAAT4 in mouse brain and several other lysate.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EAAT4 antibody 12876-1-AP | Download protocol |
| WB protocol for EAAT4 antibody 12876-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Rep Impact of Reduced Cerebellar EAAT Expression on Purkinje Cell Firing Pattern of NPC1-deficient Mice. | ||
Cancer Immunol Immunother Glutamate transporter SLC1A6 promotes resistance to immunotherapy in cancer | ||





