Tested Applications
Positive WB detected in | mouse liver tissue, rat liver tissue |
Positive IP detected in | mouse liver tissue |
Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
Product Information
24617-1-AP targets SLC22A1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18806 Product name: Recombinant human SLC22A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 275-357 aa of BC126364 Sequence: FLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTD Predict reactive species |
Full Name | solute carrier family 22 (organic cation transporter), member 1 |
Calculated Molecular Weight | 554 aa, 61 kDa |
Observed Molecular Weight | 61-67 kDa |
GenBank Accession Number | BC126364 |
Gene Symbol | SLC22A1 |
Gene ID (NCBI) | 6580 |
RRID | AB_2879641 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O15245 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC22A1 antibody 24617-1-AP | Download protocol |
IHC protocol for SLC22A1 antibody 24617-1-AP | Download protocol |
IP protocol for SLC22A1 antibody 24617-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab PGC-1α Promotes Breast Cancer Metastasis and Confers Bioenergetic Flexibility against Metabolic Drugs. | ||
J Food Biochem Effects of black tea and black brick tea with fungal growth on lowering uric acid levels in hyperuricemic mice. | ||
J Pharm Anal Discovering metabolic vulnerability using spatially resolved metabolomics for antitumor small molecule-drug conjugates development as a precise cancer therapy strategy | ||
Nat Chem Biol Cardiac contraction and relaxation are regulated by distinct subcellular cAMP pools |