Tested Applications
Positive WB detected in | L02 cells, mouse kidney tissue, mouse liver tissue, rat liver tissue |
Positive IP detected in | mouse liver tissue |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24901-1-AP targets SLC22A23 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19036 Product name: Recombinant human SLC22A23 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 84-186 aa of BC128580 Sequence: ESLRWLMATQQFESAKRLILHFTQKNRMNPEGDIKGVIPELEKELSRRPKKVCIVKVVGTRNLWKNIVVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYA Predict reactive species |
Full Name | solute carrier family 22, member 23 |
Calculated Molecular Weight | 686 aa, 74 kDa |
Observed Molecular Weight | 66-74 kDa |
GenBank Accession Number | BC128580 |
Gene Symbol | SLC22A23 |
Gene ID (NCBI) | 63027 |
RRID | AB_2879787 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | A1A5C7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC22A23 antibody 24901-1-AP | Download protocol |
IHC protocol for SLC22A23 antibody 24901-1-AP | Download protocol |
IP protocol for SLC22A23 antibody 24901-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |