Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Positive IHC detected in | mouse brain tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 9 publications below |
IHC | See 1 publications below |
IF | See 3 publications below |
Product Information
21430-1-AP targets SLC24A6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16034 Product name: Recombinant human SLC24A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 240-333 aa of BC098360 Sequence: YVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLP Predict reactive species |
Full Name | solute carrier family 24 (sodium/potassium/calcium exchanger), member 6 |
Calculated Molecular Weight | 584 aa, 64 kDa |
Observed Molecular Weight | 64 kDa |
GenBank Accession Number | BC098360 |
Gene Symbol | SLC24A6 |
Gene ID (NCBI) | 80024 |
RRID | AB_10858637 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6J4K2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC24A6, also named as NCLX, is a kind of mitochondrial sodium/calcium antiporter that mediates sodium-dependent calcium efflux from mitochondrion by mediating the exchange of 3 sodium ions per 1 calcium ion. It has been reported that SLC24A6 plays a key role in attenuating potential ROS production and injury upon cardiac reperfusion. SLC24A6 is associated with mitochondrial calcium homeostasis by mediating mitochondrial calcium extrusion. (PMID: 32728214, 20018762, 28219928)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC24A6 antibody 21430-1-AP | Download protocol |
IHC protocol for SLC24A6 antibody 21430-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun The mitochondrial fusion protein OPA1 is dispensable in the liver and its absence induces mitohormesis to protect liver from drug-induced injury | ||
J Cardiovasc Transl Res CD137 Signal Mediates Cardiac Ischemia-Reperfusion Injury by Regulating the Necrosis of Cardiomyocytes. | ||
Oncol Lett Dihydroartemisinin inhibits liver cancer cell migration and invasion by reducing ATP synthase production through CaMKK2/NCLX | ||
Cell Biochem Biophys Astragalus Polysaccharides Reduce High-glucose-induced Rat Aortic Endothelial Cell Senescence and Inflammasome Activation by Modulating the Mitochondrial Na+/Ca2+ Exchanger. | ||
J Geriatr Cardiol The mitochondrial Na(+)/Ca(2+) exchanger may reduce high glucose-induced oxidative stress and nucleotide-binding oligomerization domain receptor 3 inflammasome activation in endothelial cells.
| ||
Cell Death Dis Lon upregulation contributes to cisplatin resistance by triggering NCLX-mediated mitochondrial Ca2+ release in cancer cells. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Marco (Verified Customer) (07-09-2024) | visible band at the right size
|