Tested Applications
Positive WB detected in | RAW 264.7 cells, RAW264.7 cells |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
21568-1-AP targets SLC25A25 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16086 Product name: Recombinant human SLC25A25 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC103933 Sequence: MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQ Predict reactive species |
Full Name | solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 |
Calculated Molecular Weight | 469 aa, 53 kDa |
Observed Molecular Weight | 50 kDa, 100 kDa |
GenBank Accession Number | BC103933 |
Gene Symbol | SLC25A25 |
Gene ID (NCBI) | 114789 |
RRID | AB_10858638 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6KCM7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC25A25 antibody 21568-1-AP | Download protocol |
IHC protocol for SLC25A25 antibody 21568-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |