Tested Applications
| Positive WB detected in | C2C12 cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13966-1-AP targets ZnT7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4957 Product name: Recombinant human SLC30A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 287-376 aa of BC064692 Sequence: RESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFTQAGVRQLYVQIDFAAM Predict reactive species |
| Full Name | solute carrier family 30 (zinc transporter), member 7 |
| Calculated Molecular Weight | 42 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC064692 |
| Gene Symbol | SLC30A7 |
| Gene ID (NCBI) | 148867 |
| RRID | AB_2189776 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NEW0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
ZnT7 Polyclonal antibody (Cat# 13966-1-AP) has 12 citations published in journals including Acta Neuropathol Commun, Front Physiol, J Neurosci Res, Am J Physiol Gastrointest Liver Physiol, Metallomics, FEBS Open Bio, Biol Open, Poult Sci, J Anim Sci, J Trace Elem Med Biol, and bioRxiv. Research fields span zinc/biometal homeostasis, neurodegenerative diseases (ALS, neuronal ceroid lipofuscinosis), alcoholic liver disease, intestinal physiology, reproductive biology, and immune function.
| Species | Application | Title |
|---|---|---|
Acta Neuropathol Commun Deregulation of subcellular biometal homeostasis through loss of the metal transporter, Zip7, in a childhood neurodegenerative disorder. | ||
Poult Sci The organic zinc with moderate chelation strength enhances the expression of related transporters in the jejunum and ileum of broilers | ||
Front Physiol Organic zinc with moderate chelation strength enhances zinc absorption in the small intestine and expression of related transporters in the duodenum of broilers | ||
J Trace Elem Med Biol Ginsenoside Rb1 combined with Lycium barbarum polysaccharide alleviate the Tripterygium wilfordii polyglycoside-induced oligoasthenozoospermia in mice by inhibiting ZnT3-mediated oxidative stress response | ||
J Anim Sci Zinc proteinate with moderate chelation strength enhances zinc absorption by upregulating the expression of zinc and amino acid transporters in primary cultured duodenal epithelial cells of broiler embryos | ||
J Neurosci Res Zinc transporters ZnT3 and ZnT6 are downregulated in the spinal cords of patients with sporadic amyotrophic lateral sclerosis. |
